Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201267_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WISP2Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

Rabbit WISP2 Polyclonal Antibody | anti-WISP2 antibody

WISP2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CCN5; CT58; WISP2; CTGF-L
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WISP2, Antibody; WISP2 antibody - C-terminal region; anti-WISP2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: WGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Sequence Length
250
Applicable Applications for anti-WISP2 antibody
WB (Western Blot)
Predicted Homology
Based on Immunogen Sequence: Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 79%
Protein Size (# AA)
250 amino acids
Protein Interactions
HDAC3; HDAC1; IGF1R; IGF2R;
Replacement Item
This antibody may replace item sc-116953 from Santa Cruz Biotechnology.
Blocking Peptide
For anti-WISP2 (MBS3216315) antibody is Catalog #
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express WISP2.
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express WISP2.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: WISP2Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

product-image-AAA201267_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WISP2Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

WB (Western Blot)

(HeLaWISP2 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201267_WB15.jpg WB (Western Blot) (HeLaWISP2 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-WISP2 antibody
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
WNT1-inducible-signaling pathway protein 2 isoform 1
NCBI Official Synonym Full Names
cellular communication network factor 5
NCBI Official Symbol
CCN5
NCBI Official Synonym Symbols
CT58; WISP2; CTGF-L
NCBI Protein Information
WNT1-inducible-signaling pathway protein 2
UniProt Protein Name
WNT1-inducible-signaling pathway protein 2
UniProt Gene Name
WISP2
UniProt Synonym Gene Names
CCN5; CT58; CTGFL; WISP-2; CTGF-L
UniProt Entry Name
WISP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WISP2 wisp2 (Catalog #AAA201267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WISP2 antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WISP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the WISP2 wisp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WGPCSTTCGL GMATRVSNQN RFCRLETQRR LCLSRPCPPS RGRSPQNSAF. It is sometimes possible for the material contained within the vial of "WISP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.