Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197289_WB10.jpg WB (Western Blot) (WB Suggested Anti-WNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit WNT1 Polyclonal Antibody | anti-WNT1 antibody

WNT1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
WNT1; INT1; OI15; BMND16
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WNT1, Antibody; WNT1 antibody - middle region; anti-WNT1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
Sequence Length
370
Applicable Applications for anti-WNT1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WNT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

product-image-AAA197289_WB10.jpg WB (Western Blot) (WB Suggested Anti-WNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: WNT1Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA197289_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: WNT1Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: WNT1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA197289_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: WNT1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: Human H9Sample Type: 1. Molecular Weight2. Control (20ug)3. shRNA1-WNT1 H9 hES cells (20ug)4.ÂshRNA2-WNT1 H9 hES cells (20ug)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit HRPSecondary Dilution: 1:5000Image Submitted By: Jingli CaiThomas Jefferson UniversityÂ)

product-image-AAA197289_WB15.jpg WB (Western Blot) (Sample Type: Human H9Sample Type: 1. Molecular Weight2. Control (20ug)3. shRNA1-WNT1 H9 hES cells (20ug)4.ÂshRNA2-WNT1 H9 hES cells (20ug)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit HRPSecondary Dilution: 1:5000Image Submitted By: Jingli CaiThomas Jefferson UniversityÂ)
Related Product Information for anti-WNT1 antibody
This is a rabbit polyclonal antibody against WNT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. WNT1 was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. WNT1 is clustered with another family member, WNT10B, in the chromosome 12q13 region.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
proto-oncogene Wnt-1
NCBI Official Synonym Full Names
Wnt family member 1
NCBI Official Symbol
WNT1
NCBI Official Synonym Symbols
INT1; OI15; BMND16
NCBI Protein Information
proto-oncogene Wnt-1
UniProt Protein Name
Proto-oncogene Wnt-1
UniProt Gene Name
WNT1
UniProt Synonym Gene Names
INT1
UniProt Entry Name
WNT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WNT1 wnt1 (Catalog #AAA197289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WNT1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WNT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the WNT1 wnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGREFVDSGE KGRDLRFLMN LHNNEAGRTT VFSEMRQECK CHGMSGSCTV. It is sometimes possible for the material contained within the vial of "WNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.