Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281738_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human esophageal using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit WWC1 Polyclonal Antibody | anti-WWC1 antibody

WWC1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
WWC1; KIBRA; HBEBP3; HBEBP36; MEMRYQTL; PPP1R168
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
WWC1, Antibody; WWC1 Rabbit pAb; WWC1; HBEBP3; HBEBP36; KIBRA; MEMRYQTL; PPP1R168; anti-WWC1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
STLSKKPPFVRNSLERRSVRMKRPSPPPQPSSVKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLEQAKSHGEKELPQWLREDERFRLLL
Applicable Applications for anti-WWC1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human WWC1 (NP_001155133.1).
Positive Samples
HeLa, Mouse lung, Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human esophageal using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281738_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human esophageal using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat ovary using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281738_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat ovary using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse spinal cord using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281738_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse spinal cord using WWC1 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using WWC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281738_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using WWC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-WWC1 antibody
Background: The protein encoded by this gene is a cytoplasmic phosphoprotein that interacts with PRKC-zeta and dynein light chain-1. Alleles of this gene have been found that enhance memory in some individuals. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-WWC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125,905 Da
NCBI Official Full Name
protein KIBRA isoform 1
NCBI Official Synonym Full Names
WW and C2 domain containing 1
NCBI Official Symbol
WWC1
NCBI Official Synonym Symbols
KIBRA; HBEBP3; HBEBP36; MEMRYQTL; PPP1R168
NCBI Protein Information
protein KIBRA; HBeAg-binding protein 3; WW, C2 and coiled-coil domain containing 1; kidney and brain protein; protein WWC1; protein phosphatase 1, regulatory subunit 168
UniProt Protein Name
Protein KIBRA
UniProt Gene Name
WWC1
UniProt Synonym Gene Names
KIAA0869; KIBRA
UniProt Entry Name
KIBRA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WWC1 wwc1 (Catalog #AAA281738) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWC1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WWC1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the WWC1 wwc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: STLSKKPPFV RNSLERRSVR MKRPSPPPQP SSVKSLRSER LIRTSLDLEL DLQATRTWHS QLTQEISVLK ELKEQLEQAK SHGEKELPQW LREDERFRLL L. It is sometimes possible for the material contained within the vial of "WWC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.