Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46573_IHC11.jpg IHC (Immunohistochemisry) (ZBTB7A was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

anti-Mouse, Rat ZBTB7A Polyclonal Antibody | anti-ZBTB7A antibody

Anti-ZBTB7A Antibody

Average rating 0.0
No ratings yet
Gene Names
Zbtb7a; Lrf; FBI-1; Zbtb7; Pokemon; AI452336; 9030619K07Rik; 9130006G12Rik
Reactivity
Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ZBTB7A, Antibody; Anti-ZBTB7A Antibody; Zinc finger and BTB domain-containing protein 7A; DKFZp547O146; Factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI-1; FBI1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; HIV-1 inducer of short transcripts-binding factor 1; Leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; ZBT7A_HUMAN; ZBTB7; ZBTB7A; Zinc finger and BTB domain containing 7A; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; Zinc finger protein 857A; Zinc finger- and BTB domain-containing protein 7; ZNF857A; zinc finger and BTB domain containing 7A; anti-ZBTB7A antibody
Ordering
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
569
Applicable Applications for anti-ZBTB7A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse ZBTB7A (125-163aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(ZBTB7A was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46573_IHC11.jpg IHC (Immunohistochemisry) (ZBTB7A was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(ZBTB7A was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46573_IHC13.jpg IHC (Immunohiostchemistry) (ZBTB7A was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of ZBTB7A expression in mouse kidney extract (lane 1) and NIH3T3 whole cell lysates (lane 2). ZBTB7A at 75KD was detected using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46573_WB15.jpg WB (Western Blot) (Western blot analysis of ZBTB7A expression in mouse kidney extract (lane 1) and NIH3T3 whole cell lysates (lane 2). ZBTB7A at 75KD was detected using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-ZBTB7A antibody
Description: Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Mouse;Rat.

Background: Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors.
References
1. "Entrez Gene: ZBTB7A zinc finger and BTB domain containing 7A". 2. Wang, G., Lunardi, A., Zhang, J., Chen, Z., Ala, U., Webster, K. A., Tay, Y., Gonzalez-Billalabeitia, E., Egia, A., Shaffer, D. R., Carver, B., Liu, X.-S., Taulli, R., Kuo, W. P., Nardella, C., Signoretti, S., Cordon-Cardo, C., Gerald, W. L., Pandolfi, P. P. Zbtb7a suppresses prostate cancer through repression of a Sox9-dependent pathway for cellular senescence bypass and tumor invasion. Nature Genet. 45: 739-746, 2013.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,778 Da
NCBI Official Full Name
zinc finger and BTB domain-containing protein 7A
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 7a
NCBI Official Symbol
Zbtb7a
NCBI Official Synonym Symbols
Lrf; FBI-1; Zbtb7; Pokemon; AI452336; 9030619K07Rik; 9130006G12Rik
NCBI Protein Information
zinc finger and BTB domain-containing protein 7A
UniProt Protein Name
Zinc finger and BTB domain-containing protein 7A
UniProt Gene Name
Zbtb7a
UniProt Synonym Gene Names
Lrf; Zbtb7; POK erythroid myeloid ontogenic factor; Pokemon
UniProt Entry Name
ZBT7A_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZBTB7A zbtb7a (Catalog #AAA46573) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ZBTB7A Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB7A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ZBTB7A zbtb7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZBTB7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.