Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281868_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using ZC3H12D Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ZC3H12D Polyclonal Antibody | anti-ZC3H12D antibody

ZC3H12D Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ZC3H12D; TFL; p34; MCPIP4; C6orf95; dJ281H8.1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
ZC3H12D, Antibody; ZC3H12D Rabbit pAb; C6orf95; MCPIP4; TFL; dJ281H8.1; p34; ZC3H12D; anti-ZC3H12D antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP
Applicable Applications for anti-ZC3H12D antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2).
Positive Samples
U-87MG, THP-1, Mouse spleen, Mouse liver, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using ZC3H12D Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281868_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using ZC3H12D Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ZC3H12D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281868_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ZC3H12D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,199 Da
NCBI Official Full Name
hCG1749747, isoform CRA_a
NCBI Official Synonym Full Names
zinc finger CCCH-type containing 12D
NCBI Official Symbol
ZC3H12D
NCBI Official Synonym Symbols
TFL; p34; MCPIP4; C6orf95; dJ281H8.1
NCBI Protein Information
probable ribonuclease ZC3H12D; p34; tumor suppressor TFL; transformed follicular lymphoma; Zinc finger CCCH domain-containing protein 12D
UniProt Protein Name
Probable ribonuclease ZC3H12D
UniProt Gene Name
ZC3H12D
UniProt Entry Name
ZC12D_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZC3H12D zc3h12d (Catalog #AAA281868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZC3H12D Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZC3H12D can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ZC3H12D zc3h12d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QHVLAELERQ AVLVYTPSRK VHGKRLVCYD DRYIVKVAYE QDGVIVSNDN YRDLQSENPE WKWFIEQRLL MFSFVNDRFM P. It is sometimes possible for the material contained within the vial of "ZC3H12D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.