Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197619_WB15.jpg WB (Western Blot) (WB Suggested Anti-ZNF202 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate ZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit ZNF202 Polyclonal Antibody | anti-ZNF202 antibody

ZNF202 antibody - N-terminal region

Gene Names
ZNF202; ZSCAN42; ZKSCAN10
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF202, Antibody; ZNF202 antibody - N-terminal region; anti-ZNF202 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRR
Sequence Length
648
Applicable Applications for anti-ZNF202 antibody
WB (Western Blot)
Protein Size (# AA)
648
Peptide Sequence
Synthetic peptide located within the following region: ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRR
Protein Interactions
KRTAP10-3; KRT40; SNX2; MZF1; PCBD1; SCAND1; ZNF473;
Blocking Peptide
For anti-ZNF202 (MBS3201590) antibody is Catalog # MBS3226599
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF202
Sample Type Confirmation
ZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Replacement Item
This antibody may replace item sc-101074 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF202 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate ZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197619_WB15.jpg WB (Western Blot) (WB Suggested Anti-ZNF202 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate ZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-ZNF202 antibody
ZNF202 is a transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), transporters involved in lipid homeostasis (ABCA1, ABCG1), and several genes involved in processes related to energy metabolism and vascular disease.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
zinc finger protein 202 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 202
NCBI Official Symbol
ZNF202
NCBI Official Synonym Symbols
ZSCAN42; ZKSCAN10
NCBI Protein Information
zinc finger protein 202
UniProt Protein Name
Zinc finger protein 202
UniProt Gene Name
ZNF202
UniProt Synonym Gene Names
ZKSCAN10
UniProt Entry Name
ZN202_HUMAN

Similar Products

Product Notes

The ZNF202 znf202 (Catalog #AAA197619) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF202 antibody - N-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF202 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ZNF202 znf202 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATAVEPEDQD LWEEEGILMV KLEDDFTCRP ESVLQRDDPV LETSHQNFRR. It is sometimes possible for the material contained within the vial of "ZNF202, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.