SDS-PAGE
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) Recombinant Protein | PPP1CB recombinant protein
Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB)
Gene Names
PPP1CB; PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB); N/A; Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB); Serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; EC=3.1.3.16; EC=3.1.3.53; PPP1CB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-327aa; Full Length of Mature Protein
Sequence
ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for PPP1CB recombinant protein
Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).
Product Categories/Family for PPP1CB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41.1 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase PP1-beta catalytic subunit isoform 1
NCBI Official Synonym Full Names
protein phosphatase 1, catalytic subunit, beta isozyme
NCBI Official Symbol
PPP1CB
NCBI Official Synonym Symbols
PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
NCBI Protein Information
serine/threonine-protein phosphatase PP1-beta catalytic subunit; protein phosphatase 1-beta; protein phosphatase 1-delta; epididymis secretory sperm binding protein Li 80p; protein phosphatase 1, catalytic subunit, beta isoform; protein phosphatase 1, catalytic subunit, delta isoform; serine/threonine protein phosphatase PP1-beta catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-beta catalytic subunit
UniProt Gene Name
PPP1CB
UniProt Synonym Gene Names
PP-1B; PPP1CD
UniProt Entry Name
PP1B_HUMAN
Similar Products
Product Notes
The PPP1CB ppp1cb (Catalog #AAA114004) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-327aa; Full Length of Mature Protein. The amino acid sequence is listed below: ADGELNVDSL ITRLLEVRGC RPGKIVQMTE AEVRGLCIKS REIFLSQPIL LELEAPLKIC GDIHGQYTDL LRLFEYGGFP PEANYLFLGD YVDRGKQSLE TICLLLAYKI KYPENFFLLR GNHECASINR IYGFYDECKR RFNIKLWKTF TDCFNCLPIA AIVDEKIFCC HGGLSPDLQS MEQIRRIMRP TDVPDTGLLC DLLWSDPDKD VQGWGENDRG VSFTFGADVV SKFLNRHDLD LICRAHQVVE DGYEFFAKRQ LVTLFSAPNY CGEFDNAGGM MSVDETLMCS FQILKPSEKK AKYQYGGLNS GRPVTPPRTA NPPKKR. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.