Serine/threonine-protein phosphatase 2A activator (PPP2R4) Recombinant Protein | PPP2R4 recombinant protein
Recombinant Human Serine/threonine-protein phosphatase 2A activator (PPP2R4)
Gene Names
PPP2R4; PP2A; PR53; PTPA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein phosphatase 2A activator (PPP2R4); N/A; Recombinant Human Serine/threonine-protein phosphatase 2A activator (PPP2R4); Serine/threonine-protein phosphatase 2A activator; EC=5.2.1.8; PP2A, subunit B', PR53 isoform; Phosphotyrosyl phosphatase activator; PTPA; Serine/threonine-protein phosphatase 2A regulatory subunit 4; Serine/threonine-protein phosphatase 2A regulatory sub; PPP2R4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-358. Full Length of Mature Protein
Sequence
AEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PPP2R4 recombinant protein
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg2+. Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg2+ (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activity of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.5 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A activator isoform e
NCBI Official Synonym Full Names
protein phosphatase 2A activator, regulatory subunit 4
NCBI Official Symbol
PPP2R4
NCBI Official Synonym Symbols
PP2A; PR53; PTPA
NCBI Protein Information
serine/threonine-protein phosphatase 2A activator; PP2A phosphatase activator; PP2A subunit B' isoform PR53; phosphotyrosyl phosphatase activator; protein phosphatase 2A, regulatory subunit B' (PR 53); serine/threonine-protein phosphatase 2A regulatory subunit B'
UniProt Protein Name
Serine/threonine-protein phosphatase 2A activator
UniProt Gene Name
PPP2R4
UniProt Synonym Gene Names
PTPA; PTPA
UniProt Entry Name
PTPA_HUMAN
Similar Products
Product Notes
The PPP2R4 ppp2r4 (Catalog #AAA116884) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-358. Full Length of Mature Protein. The amino acid sequence is listed below: AEGERQPPPD SSEEAPPATQ NFIIPKKEIH TVPDMGKWKR SQAYADYIGF ILTLNEGVKG KKLTFEYRVS EMWNEVHEEK EQAAKQSVSC DECIPLPRAG HCAPSEAIEK LVALLNTLDR WIDETPPVDQ PSRFGNKAYR TWYAKLDEEA ENLVATVVPT HLAAAVPEVA VYLKESVGNS TRIDYGTGHE AAFAAFLCCL CKIGVLRVDD QIAIVFKVFN RYLEVMRKLQ KTYRMEPAGS QGVWGLDDFQ FLPFIWGSSQ LIDHPYLEPR HFVDEKAVNE NHKDYMFLEC ILFITEMKTG PFAEHSNQLW NISAVPSWSK VNQGLIRMYK AECLEKFPVI QHFKFGSLLP IHPVTSG. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein phosphatase 2A activator (PPP2R4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
