Bone marrow proteoglycan (PRG2) Recombinant Protein | PRG2 recombinant protein
Recombinant Human Bone marrow proteoglycan (PRG2), partial
Gene Names
PRG2; MBP; BMPG; MBP1; proMBP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bone marrow proteoglycan (PRG2); N/A; Recombinant Human Bone marrow proteoglycan (PRG2), partial; Proteoglycan 2; Cleaved into the following chain; Eosinophil granule major basic protein; EMBP; MBP; Pregnancy-associated major basic protein; PRG2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
106-222aa; Full Length of Mature Protein
Sequence
TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Species
Homo sapiens(Human)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Related Product Information for PRG2 recombinant protein
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Product Categories/Family for PRG2 recombinant protein
References
"Cloning and sequence analysis of the human gene encoding eosinophil major basic protein."Barker R.L., Loegering D.A., Arakawa K.C., Pease L.R., Gleich G.J.Gene 86:285-289(1990)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.8 kDa
NCBI Official Full Name
bone marrow proteoglycan isoform 2 preproprotein
NCBI Official Synonym Full Names
proteoglycan 2, pro eosinophil major basic protein
NCBI Official Symbol
PRG2
NCBI Official Synonym Symbols
MBP; BMPG; MBP1; proMBP
NCBI Protein Information
bone marrow proteoglycan
UniProt Protein Name
Bone marrow proteoglycan
UniProt Gene Name
PRG2
UniProt Synonym Gene Names
MBP; BMPG; EMBP; MBP
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PRG2 prg2 (Catalog #AAA233492) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 106-222aa; Full Length of Mature Protein. The amino acid sequence is listed below: TCRYLLVRSL QTFSQAWFTC RRCYRGNLVS IHNFNINYRI QCSVSALNQG QVWIGGRITG SGRCRRFQWV DGSRWNFAYW AAHQPWSRGG HCVALCTRGG HWRRAHCLRR LPFICSY. It is sometimes possible for the material contained within the vial of "Bone marrow proteoglycan (PRG2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
