Neurotrypsin Recombinant Protein | PRSS12 recombinant protein
Recombinant Human Neurotrypsin
Gene Names
PRSS12; MRT1; BSSP3; BSSP-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurotrypsin ; N/A; Recombinant Human Neurotrypsin ; Leydin; Motopsin; Serine protease 12; PRSS12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
631-874aa; partial
Sequence
IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for PRSS12 recombinant protein
Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
Product Categories/Family for PRSS12 recombinant protein
References
"Cloning and sequencing of the cDNA encoding human neurotrypsin." Proba K., Gschwend T.P., Sonderegger P. Biochim. Biophys. Acta 1396:143-147(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.4 kDa
NCBI Official Full Name
neurotrypsin
NCBI Official Synonym Full Names
protease, serine 12
NCBI Official Symbol
PRSS12
NCBI Official Synonym Symbols
MRT1; BSSP3; BSSP-3
NCBI Protein Information
neurotrypsin
UniProt Protein Name
Neurotrypsin
UniProt Gene Name
PRSS12
UniProt Entry Name
NETR_HUMAN
Similar Products
Product Notes
The PRSS12 prss12 (Catalog #AAA18416) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 631-874aa; partial. The amino acid sequence is listed below: IIGGKNSLRG GWPWQVSLRL KSSHGDGRLL CGATLLSSCW VLTAAHCFKR YGNSTRSYAV RVGDYHTLVP EEFEEEIGVQ QIVIHREYRP DRSDYDIALV RLQGPEEQCA RFSSHVLPAC LPLWRERPQK TASNCYITGW GDTGRAYSRT LQQAAIPLLP KRFCEERYKG RFTGRMLCAG NLHEHKRVDS CQGDSGGPLM CERPGESWVV YGVTSWGYGC GVKDSPGVYT KVSAFVPWIK SVTK . It is sometimes possible for the material contained within the vial of "Neurotrypsin , Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.