Brain-specific serine protease 4 (Prss22) Recombinant Protein | Prss22 recombinant protein
Recombinant Mouse Brain-specific serine protease 4 (Prss22)
Gene Names
Prss22; BSSP-4; SP001LA; 4733401N09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Brain-specific serine protease 4 (Prss22); N/A; Recombinant Mouse Brain-specific serine protease 4 (Prss22); Prss22 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-306. Full Length of Mature Protein
Sequence
ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCADDRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSS
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Prss22 recombinant protein
This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa
NCBI Official Full Name
brain-specific serine protease 4
NCBI Official Synonym Full Names
protease, serine 22
NCBI Official Symbol
Prss22
NCBI Official Synonym Symbols
BSSP-4; SP001LA; 4733401N09Rik
NCBI Protein Information
brain-specific serine protease 4
UniProt Protein Name
Brain-specific serine protease 4
UniProt Gene Name
Prss22
UniProt Synonym Gene Names
Bssp4; Prss26; BSSP-4
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Prss22 prss22 (Catalog #AAA116812) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-306. Full Length of Mature Protein. The amino acid sequence is listed below: ATIRVSPDCG KPQQLNRIVG GEDSMDAQWP WIVSILKNGS HHCAGSLLTN RWVVTAAHCF KSNMDKPSLF SVLLGAWKLG SPGPRSQKVG IAWVLPHPRY SWKEGTHADI ALVRLEHSIQ FSERILPICL PDSSVRLPPK TDCWIAGWGS IQDGVPLPHP QTLQKLKVPI IDSELCKSLY WRGAGQEAIT EGMLCAGYLE GERDACLGDS GGPLMCQVDD HWLLTGIISW GEGCADDRPG VYTSLLAHRS WVQRIVQGVQ LRGYLADSGD TGSS. It is sometimes possible for the material contained within the vial of "Brain-specific serine protease 4 (Prss22), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.