Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Receptor-type tyrosine-protein phosphatase gamma (PTPRG) Recombinant Protein | PTPRG recombinant protein

Recombinant Chicken Receptor-type tyrosine-protein phosphatase gamma (PTPRG), partial

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Receptor-type tyrosine-protein phosphatase gamma (PTPRG); N/A; Recombinant Chicken Receptor-type tyrosine-protein phosphatase gamma (PTPRG), partial; PTPRG recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
822-1098. Partial
Sequence
QHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVSGYNKAKAYIATQGPLKSTFEDFWRMIWAQHTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTNIHACYTVRPLHGQEHKDEKGSERKPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARTPHMGPVVVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAIL
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PTPRG recombinant protein
This protein is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA
ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
159,767 Da
NCBI Official Full Name
Receptor-type tyrosine-protein phosphatase gamma
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase gamma
UniProt Gene Name
PTPRG
UniProt Synonym Gene Names
Protein-tyrosine phosphatase gamma; R-PTP-gamma

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTPRG ptprg (Catalog #AAA117627) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 822-1098. Partial. The amino acid sequence is listed below: QHGFSEDFEE VQRCTADMNI TAEHSNHPDN KHKNRYINIL AYDHSRVKLR PLPGKDSKHS DYINANYVSG YNKAKAYIAT QGPLKSTFED FWRMIWAQHT GIIVMITNLV EKGRRKCDQY WPTENSEEYG NIIVTLKSTN IHACYTVRPL HGQEHKDEKG SERKPKGRQN ERTVIQYHYT QWPDMGVPEY ALPVLTFVRR SSAARTPHMG PVVVHCSAGV GRTGTYIVID SMLQQIKDKS TVNVLGFLKH IRTQRNYLVQ TEEQYIFIHD ALLEAIL. It is sometimes possible for the material contained within the vial of "Receptor-type tyrosine-protein phosphatase gamma (PTPRG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.