Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Ras-Related C3 Botulinum Toxin substrate 1 Recombinant Protein | RAC1 recombinant protein

Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1

Average rating 0.0
No ratings yet
Gene Names
RAC1; MIG5; Rac-1; TC-25; p21-Rac1
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
Ras-Related C3 Botulinum Toxin substrate 1; N/A; Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1; RAC1 Human; Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant; P21-RAC1; RAC-1; RAC1; RAS-like protein TC25; MIG5; Cell-migration-inducing gene 5 protein; Ras-related C3 botulinum toxin substrate 1; rho family small GTP binding protein Rac1; TC-25; MGC111543; RAC1 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Sterile Filtered colorless solution.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Sequence Length
192
Related Product Information for RAC1 recombinant protein
Description: Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.

Introduction: RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,467 Da
NCBI Official Full Name
ras-related C3 botulinum toxin substrate 1 isoform Rac1
NCBI Official Synonym Full Names
ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
NCBI Official Symbol
RAC1
NCBI Official Synonym Symbols
MIG5; Rac-1; TC-25; p21-Rac1
NCBI Protein Information
ras-related C3 botulinum toxin substrate 1; cell migration-inducing gene 5 protein; ras-like protein TC25
UniProt Protein Name
Ras-related C3 botulinum toxin substrate 1
UniProt Gene Name
RAC1
UniProt Synonym Gene Names
TC25
UniProt Entry Name
RAC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAC1 rac1 (Catalog #AAA38519) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MQAIKCVVVG DGAVGKTCLL ISYTTNAFPG EYIPTVFDNY SANVMVDGKP VNLGLWDTAQ EDYDRLRPLS YPQTDVFLIC FSLVSPASFE NVRAKWYPEV RHHCPNTPII LVGTKLDLRD DKDTIEKLKE KKLTPITYPQ GLAMAKEIGA VKYLECSALT QRGLKTVFDE AIRAVLCP PPVKKRKRKC LLL. It is sometimes possible for the material contained within the vial of "Ras-Related C3 Botulinum Toxin substrate 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.