Growth Hormone Active Protein | raGHBP active protein
Recombinant Rabbit Growth Hormone Binding Protein
Purity
Greater than 98.0% as determined bySDS-PAGE.
Synonyms
Growth Hormone; N/A; Recombinant Rabbit Growth Hormone Binding Protein; GHBP Rabbit; Growth Hormone Binding Protein Rabbit Recombinant; GHR; GHBP; GH receptor; Somatotropin receptor; raGHBP active protein
Purity/Purification
Greater than 98.0% as determined bySDS-PAGE.
Form/Format
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Sequence Length
638
Source
Escherichia Coli.
Solubility
It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Evidended by its ability of forming 2:1 complex with non-primate Growth Hormones.
Preparation and Storage
Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution GHBP Rabbit should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for raGHBP active protein
Description: Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.
Introduction:
GHBP is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized.
Introduction:
GHBP is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized.
Product Categories/Family for raGHBP active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
growth hormone receptor
NCBI Official Symbol
GHR
NCBI Protein Information
growth hormone receptor; GH receptor; somatotropin receptor
UniProt Protein Name
Growth hormone receptor
UniProt Gene Name
GHR
UniProt Synonym Gene Names
GH receptor; GH-binding protein; GHBP
UniProt Entry Name
GHR_RABIT
Similar Products
Product Notes
The raGHBP ghr (Catalog #AAA38592) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AFSGSEATPA TLGRASESVQ RVHPGLGTNS SGKPKFTKCR SPELETFSCH WTDGVHHGLK SPGSVQLFYI RRNTQEWTQE WKECPDYVSA GENSCYFNSS YTSIWIPYCI KLTNNGGMVD QKCFSVEEIV QPDPPIGLNW TLLNVSLTGI HADIQVRWEP PPNADVQKGW IVLEYELQYK EVNETQWKMM DPVLSTSVPV YSLRLDKEYE VRVRSRQRSS EKYGEFSEVL YVTLPQMSPF TCEEDFRFP. It is sometimes possible for the material contained within the vial of "Growth Hormone, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.