Retinol-binding protein 3 Recombinant Protein | RBP3 recombinant protein
Recombinant Bovine Retinol-binding protein 3
Gene Names
RBP3; IRBP; RBPI; RP66; D10S64; D10S65; D10S66
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retinol-binding protein 3; N/A; Recombinant Bovine Retinol-binding protein 3; Interphotoreceptor retinoid-binding protein; IRBP; Interstitial retinol-binding protein; RBP3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
933-1231aa; Partial
Sequence
AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT
Sequence Length
1247
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for RBP3 recombinant protein
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
References
Human interstitial retinoid-binding protein. Gene structure and primary structure.Liou G.I., Ma D.-P., Yang Y.-W., Geng L., Zhu C., Baehr W.J. Biol. Chem. 264:8200-8206(1989) Characterization and comparative structural features of the gene for human interstitial retinol-binding protein.Fong S.-L., Fong W.B., Morris T.A., Kedzie K.M., Bridges C.D.B.J. Biol. Chem. 265:3648-3653(1990) Cloning of cDNAs encoding human interphotoreceptor retinoid-binding protein (IRBP) and comparison with bovine IRBP sequences.Si J.S., Borst D.E., Redmond T.M., Nickerson J.M.Gene 80:99-108(1989) Internal quadruplication in the structure of human interstitial retinol-binding protein deduced from its cloned cDNA.Fong S.-L., Bridges C.D.B.J. Biol. Chem. 263:15330-15334(1988) Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S.Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011) The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59.5 kDa
NCBI Official Full Name
retinol-binding protein 3
NCBI Official Synonym Full Names
retinol binding protein 3
NCBI Official Symbol
RBP3
NCBI Official Synonym Symbols
IRBP; RBPI; RP66; D10S64; D10S65; D10S66
NCBI Protein Information
retinol-binding protein 3
UniProt Protein Name
Retinol-binding protein 3
UniProt Gene Name
RBP3
UniProt Synonym Gene Names
IRBP
UniProt Entry Name
RET3_HUMAN
Similar Products
Product Notes
The RBP3 rbp3 (Catalog #AAA113875) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 933-1231aa; Partial. The amino acid sequence is listed below: AKVPTVLQTA GKLVADNYAS PELGVKMAAE LSGLQSRYAR VTSEAALAEL LQADLQVLSG DPHLKTAHIP EDAKDRIPGI VPMQIPSPEV FEDLIKFSFH TNVLEGNVGY LRFDMFGDCE LLTQVSELLV EHVWKKIVHT DALIVDMRFN IGGPTSSISA LCSYFFDEGP PILLDKIYNR PNNSVSELWT LSQLEGERYG SKKSMVILTS TLTAGAAEEF TYIMKRLGRA LVIGEVTSGG CQPPQTYHVD DTDLYLTIPT ARSVGAADGS SWEGVGVVPD VAVPAEAALT RAQEMLQHT. It is sometimes possible for the material contained within the vial of "Retinol-binding protein 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
