Recoverin Recombinant Protein | RECO recombinant protein
Recombinant Human Recoverin
Gene Names
RCVRN; RCV1
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Recoverin; N/A; Recombinant Human Recoverin; Cancer-associated retinopathy protein; Protein CAR; RECO recombinant protein
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol
Sequence Positions
Full Length, 2-200aa
Sequence
GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Immunogen Description
Expression Region:2-200aa Sequence Info: Full Length
Tag Info
N-terminal 6x His-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stabilityof the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C forup to one week.
Related Product Information for RECO recombinant protein
Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27 kDa
NCBI Official Full Name
recoverin
NCBI Official Synonym Full Names
recoverin
NCBI Official Symbol
RCVRN
NCBI Official Synonym Symbols
RCV1
NCBI Protein Information
recoverin
UniProt Protein Name
Recoverin
UniProt Gene Name
RCVRN
UniProt Synonym Gene Names
RCV1; Protein CAR
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RECO rcvrn (Catalog #AAA309740) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 2-200aa. The Recombinant Human Recoverin reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GNSKSGALSK EILEELQLNT KFSEEELCSW YQSFLKDCPT GRITQQQFQS IYAKFFPDTD PKAYAQHVFR SFDSNLDGTL DFKEYVIALH MTTAGKTNQK LEWAFSLYDV DGNGTISKNE VLEIVMAIFK MITPEDVKLL PDDENTPEKR AEKIWKYFGK NDDDKLTEKE FIEGTLANKE ILRLIQFEPQ KVKEKMKNA. It is sometimes possible for the material contained within the vial of "Recoverin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.