Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113422_SDS_PAGE15.jpg SDS-PAGE

Replication factor C subunit 1 (RFC1), partial Recombinant Protein | RFC1 recombinant protein

Recombinant Human Replication factor C subunit 1 (RFC1), partial

Average rating 0.0
No ratings yet
Gene Names
RFC1; A1; RFC; PO-GA; RECC1; MHCBFB; RFC140
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replication factor C subunit 1 (RFC1), partial; N/A; Recombinant Human Replication factor C subunit 1 (RFC1), partial; Replication factor C subunit 1; Activator 1 140 kDa subunit; A1 140 kDa subunit; Activator 1 large subunit; Activator 1 subunit 1; DNA-binding protein PO-GA; Replication factor C 140 kDa subunit; RF-C 140 kDa subunit; RFC140; Replication factor C large su; RFC1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
402-492. Partial-length
Sequence
GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113422_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for RFC1 recombinant protein
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.
Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.
Product Categories/Family for RFC1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.8 kDa
NCBI Official Full Name
replication factor C subunit 1 isoform 2
NCBI Official Synonym Full Names
replication factor C (activator 1) 1, 145kDa
NCBI Official Symbol
RFC1
NCBI Official Synonym Symbols
A1; RFC; PO-GA; RECC1; MHCBFB; RFC140
NCBI Protein Information
replication factor C subunit 1; A1 140 kDa subunit; RF-C 140 kDa subunit; activator 1 subunit 1; replication factor C1; MHC binding factor, beta; DNA-binding protein PO-GA; activator 1 large subunit; activator 1 140 kDa subunit; replication factor C large subunit; replication factor C 140 kDa subunit
UniProt Protein Name
Replication factor C subunit 1
UniProt Gene Name
RFC1
UniProt Synonym Gene Names
RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC140
UniProt Entry Name
RFC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RFC1 rfc1 (Catalog #AAA113422) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 402-492. Partial-length. The amino acid sequence is listed below: GAENCLEGLI FVITGVLESI ERDEAKSLIE RYGGKVTGNV SKKTNYLVMG RDSGQSKSDK AAALGTKIID EDGLLNLIRT MPGKKSKYEI A. It is sometimes possible for the material contained within the vial of "Replication factor C subunit 1 (RFC1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.