Nuclear receptor ROR-gamma (Rorc) Recombinant Protein | Rorc recombinant protein
Recombinant Mouse Nuclear receptor ROR-gamma (Rorc)
Gene Names
Rorc; TOR; Thor; Nr1f3; RORgamma
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear receptor ROR-gamma (Rorc); N/A; Recombinant Mouse Nuclear receptor ROR-gamma (Rorc); Rorc recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-516. Full length.
Sequence
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Sequence Length
516
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rorc recombinant protein
This protein is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that This protein may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60.1 kDa
NCBI Official Full Name
nuclear receptor ROR-gamma isoform 2
NCBI Official Synonym Full Names
RAR-related orphan receptor gamma
NCBI Official Symbol
Rorc
NCBI Official Synonym Symbols
TOR; Thor; Nr1f3; RORgamma
NCBI Protein Information
nuclear receptor ROR-gamma
UniProt Protein Name
Nuclear receptor ROR-gamma
UniProt Gene Name
Rorc
UniProt Synonym Gene Names
Nr1f3; Rorg; Thor; TOR
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Rorc rorc (Catalog #AAA113727) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-516. Full length. The amino acid sequence is listed below: MDRAPQRHHR TSRELLAAKK THTSQIEVIP CKICGDKSSG IHYGVITCEG CKGFFRRSQQ CNVAYSCTRQ QNCPIDRTSR NRCQHCRLQK CLALGMSRDA VKFGRMSKKQ RDSLHAEVQK QLQQQQQQEQ VAKTPPAGSR GADTLTYTLG LSDGQLPLGA SPDLPEASAC PPGLLRASGS GPPYSNTLAK TEVQGASCHL EYSPERGKAE GRDSIYSTDG QLTLGRCGLR FEETRHPELG EPEQGPDSHC IPSFCSAPEV PYASLTDIEY LVQNVCKSFR ETCQLRLEDL LRQRTNLFSR EEVTSYQRKS MWEMWERCAH HLTEAIQYVV EFAKRLSGFM ELCQNDQIIL LTAGAMEVVL VRMCRAYNAN NHTVFFEGKY GGVELFRALG CSELISSIFD FSHFLSALCF SEDEIALYTA LVLINANRPG LQEKRRVEHL QYNLELAFHH HLCKTHRQGL LAKLPPKGKL RSLCSQHVEK LQIFQHLHPI VVQAAFPPLY KELFSTDVES PEGLSK. It is sometimes possible for the material contained within the vial of "Nuclear receptor ROR-gamma (Rorc), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
