Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

X-linked retinitis pigmentosa GTPase regulator (RPGR) Recombinant Protein | RPGR recombinant protein

Recombinant Human X-linked retinitis pigmentosa GTPase regulator (RPGR) , partial

Gene Names
RPGR; CRD; RP3; COD1; PCDX; RP15; XLRP3; orf15; CORDX1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
X-linked retinitis pigmentosa GTPase regulator (RPGR); N/A; Recombinant Human X-linked retinitis pigmentosa GTPase regulator (RPGR) , partial; RPGR recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
54-367. Partial of Isoform 1
Sequence
NKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAP
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RPGR recombinant protein
This gene encodes a protein with a series of six RCC1-like domains (RLDs), characteristic of the highly conserved guanine nucleotide exchange factors. The encoded protein is found in the Golgi body and interacts with RPGRIP1. This protein localizes to the outer segment of rod photoreceptors and is essential for their viability. Mutations in this gene have been associated with X-linked retinitis pigmentosa (XLRP). Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length natures of only some have been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127,042 Da
NCBI Official Full Name
X-linked retinitis pigmentosa GTPase regulator isoform A
NCBI Official Synonym Full Names
retinitis pigmentosa GTPase regulator
NCBI Official Symbol
RPGR
NCBI Official Synonym Symbols
CRD; RP3; COD1; PCDX; RP15; XLRP3; orf15; CORDX1
NCBI Protein Information
X-linked retinitis pigmentosa GTPase regulator
UniProt Protein Name
X-linked retinitis pigmentosa GTPase regulator
UniProt Gene Name
RPGR
UniProt Synonym Gene Names
RP3; XLRP3

Similar Products

Product Notes

The RPGR rpgr (Catalog #AAA116660) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 54-367. Partial of Isoform 1. The amino acid sequence is listed below: NKLYMFGSNN WGQLGLGSKS AISKPTCVKA LKPEKVKLAA CGRNHTLVST EGGNVYATGG NNEGQLGLGD TEERNTFHVI SFFTSEHKIK QLSAGSNTSA ALTEDGRLFM WGDNSEGQIG LKNVSNVCVP QQVTIGKPVS WISCGYYHSA FVTTDGELYV FGEPENGKLG LPNQLLGNHR TPQLVSEIPE KVIQVACGGE HTVVLTENAV YTFGLGQFGQ LGLGTFLFET SEPKVIENIR DQTISYISCG ENHTALITDI GLMYTFGDGR HGKLGLGLEN FTNHFIPTLC SNFLRFIVKL VACGGCHMVV FAAP. It is sometimes possible for the material contained within the vial of "X-linked retinitis pigmentosa GTPase regulator (RPGR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.