Hepatitis B virus genotype D subtype ayw Protein X (X) Recombinant Protein | X recombinant protein
Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hepatitis B virus genotype D subtype ayw Protein X (X); N/A; Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X); HBx; Peptide X; pX; X recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-154aa; Full Length
Sequence
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Species
Hepatitis B virus genotype D subtype ayw
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for X recombinant protein
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1.
Product Categories/Family for X recombinant protein
References
"Typing hepatitis B virus by homology in nucleotide sequence: comparison of surface antigen subtypes." Okamoto H., Tsuda F., Sakugawa H., Sastrosoewignjo R.I., Imai M., Miyakawa Y., Mayumi M. J. Gen. Virol. 69:2575-2583(1988)
NCBI and Uniprot Product Information
Similar Products
Product Notes
The X x (Catalog #AAA116921) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-154aa; Full Length. The amino acid sequence is listed below: MAARLCCQLD PARDVLCLRP VGAESRGRPV SGPLGSLSSS SPSAVPTDHG AHLSLRGLPV CAFSSAGPCA LRFTSARRME TTVNAHQILP KILHKRTLGL STMSTTDLEA YFKDCLFKDW EELGEEIRLK VFVLGGCRHK LVCAPAPCNF FTSA. It is sometimes possible for the material contained within the vial of "Hepatitis B virus genotype D subtype ayw Protein X (X), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
