Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113722_SDS_PAGE15.jpg SDS-PAGE

Asc-type amino acid transporter 1 (Slc7a10) Recombinant Protein | Slc7a10 recombinant protein

Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10)

Average rating 0.0
No ratings yet
Gene Names
Slc7a10; Asc-1; AL024237; D7Bwg0847e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Asc-type amino acid transporter 1 (Slc7a10); N/A; Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10); Recombinant Asc-type amino acid transporter 1 (Slc7a10); Asc-type amino acid transporter 1; Asc-1; D-serine transporter Solute carrier family 7 member 10; Slc7a10 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
475-530aa; Partial
Sequence
WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Species
Mus musculus (Mouse)
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

SDS-PAGE

product-image-AAA113722_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Slc7a10 recombinant protein
Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.5 kDa
NCBI Official Full Name
asc-type amino acid transporter 1
NCBI Official Synonym Full Names
solute carrier family 7 (cationic amino acid transporter, y+ system), member 10
NCBI Official Symbol
Slc7a10
NCBI Official Synonym Symbols
Asc-1; AL024237; D7Bwg0847e
NCBI Protein Information
asc-type amino acid transporter 1; D-serine transporter; solute carrier family 7 member 10
UniProt Protein Name
Asc-type amino acid transporter 1
UniProt Gene Name
Slc7a10
UniProt Synonym Gene Names
Asc1; Asc-1
UniProt Entry Name
AAA1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Slc7a10 slc7a10 (Catalog #AAA113722) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 475-530aa; Partial. The amino acid sequence is listed below: WRSKPKCVHR FTESMTRWGQ ELCFVVYPQG SLEEEENGPM GQPSPLPITD KPLKTQ. It is sometimes possible for the material contained within the vial of "Asc-type amino acid transporter 1 (Slc7a10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.