Application Data
(ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseinalphasynucleinmonomersandfibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shift,andincreasedfluorescenceintensity.TheRatAlphaSynucleinmonomer isveryactiveandwasabletoformmorebeta-sheetstructurealonethanwiththecombinationofmonomerandfibril.Incombination,thefibril(AAA254099)isthemajorityoftheseed.)
Alpha Synuclein Recombinant Protein | Snca recombinant protein
Rat Recombinant Alpha Synuclein Protein Pre-formed Fibrils
Applications
SDS-Page, Western Blot
Purity
>95%; Ion-exchange Purified
Synonyms
Alpha Synuclein; N/A; Rat Recombinant Alpha Synuclein Protein Pre-formed Fibrils; Alpha Synuclein Pre-formed Fibrils; Alpha synuclein pre-formed fibrils; Alpha Synuclein PFFs; Alpha Synuclein PFF; Alpha synuclein aggregates; Alpha synuclein protein aggregates; Alpha-synuclein protein; Non-A beta component of AD amyloid protein; Non-A4 component of amyloid precursor protein; NACP protein; SNCA protein; PARK1 protein; SYN protein; Parkison disease familial 1 Protein; Snca recombinant protein
Host
E coli
Purity/Purification
>95%; Ion-exchange Purified
Form/Format
PBS pH 7.4
Concentration
Lot/batch specific. See included datasheet. (varies by lot)
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Sequence Length
Full Length
Applicable Applications for Snca recombinant protein
Invitro Assay, SDS-PAGE, WB (Western Blot)
Species
Rat
Conjugation
No Tag
Research Area
Neuroscience, Neurodegeneration, Alzheimer's Disease, Tangles & Tau, Neuroscience, Neurodegeneration, Parkinson's Disease, Synuclein, Neuroscience, Neurodegeneration, Multiple System Atrophy
Cellular Localization
Cytoplasm, Membrane, Nucleus
Certificate of Analysis
Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
Preparation and Storage
Store at -80 degree C
Application Data
(ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseinalphasynucleinmonomersandfibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shift,andincreasedfluorescenceintensity.TheRatAlphaSynucleinmonomer isveryactiveandwasabletoformmorebeta-sheetstructurealonethanwiththecombinationofmonomerandfibril.Incombination,thefibril(AAA254099)isthemajorityoftheseed.)
Application Data
(ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseinalphasynucleinmonomersandfibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shift,andincreasedfluorescenceintensity.TheRatAlphaSynucleinmonomer isveryactiveandwasabletoformmorebeta-sheetstructurealonethanwiththecombinationofmonomerandfibril.Incombination,thefibril(AAA254099)isthemajorityoftheseed.)
Application Data
(TEMofRatAlphaSynucleinPre-formedFibrils(PFFS)(AAA254099).500nm)
Application Data
(TEMofRatAlphaSynucleinPre-formedFibrils(PFFS)(AAA254099).500nm)
Application Data
(TEMofRatAlphaSynucleinPre-formedFibrils(PFFS)(AAA254099).200nm)
Application Data
(TEMofRatAlphaSynucleinPre-formedFibrils(PFFS)(AAA254099).200nm)
Related Product Information for Snca recombinant protein
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.
Product Categories/Family for Snca recombinant protein
References
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013).2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045-20478. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
4,354 Da
NCBI Official Full Name
alpha-synuclein
NCBI Official Synonym Full Names
synuclein, alpha (non A4 component of amyloid precursor)
NCBI Official Symbol
Snca
NCBI Protein Information
alpha-synuclein
UniProt Protein Name
Alpha-synuclein
UniProt Gene Name
Snca
UniProt Entry Name
SYUA_RAT
Similar Products
Product Notes
The Snca snca (Catalog #AAA254099) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Alpha Synuclein can be used in a range of immunoassay formats including, but not limited to, Invitro Assay, SDS-PAGE, WB (Western Blot). Researchers should empirically determine the suitability of the Snca snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVTTVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGNIAA ATGFVKKDQM GKGEEGYPQE GILEDMPVDP SSEAYEMPSE EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "Alpha Synuclein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.