Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA59632_AD11.jpg Application Data

Sortase A5 Recombinant Protein

Recombinant Sortase A5 protein

Average rating 0.0
No ratings yet
Synonyms
Sortase A5; N/A; Recombinant Sortase A5 protein; Sortase A5 recombinant protein
Ordering
Host
E Coli
Form/Format
Sortase A5 protein expressed in E Coli and provided at 1mg/ml in 50mM HEPES pH7.5, 150mM NaCl and 20% glycerol. Sortase A5 protein labeling set-50ug , includes:Sortase A5-50ug Reaction Buffer-1 mlStop Solution-150 ul Sortase A5 protein labeling set-250ug
Sequence
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVKLEHHHHHH
Protein Species
S. aureus
Tag
His-Tag
Protein Details
Recombinant Sortase A5 protein (S. aureaus, Uniprot A0A077UNB8-1), containing amino acid substitutions P94R, D160N, D165A, K190E and K196T, was expressed in E Coli and includes a C-terminal 6xHis-Tag
Notes
Sortase A5 recognizes an antibody or protein genetically engineered to contain the LPXTG motif (where X is any amino acid). Sortase A5 cleaves this sequence between the threonine and glycine residues and the terminal glycine is then replaced with any poly-Glycine (G)n label. Sortase A5 is used in Our Sortag-IT Labeling Kits to attach HRP, biotin, fluorophores and other labels directly to Our AbFlex recombinant antibodies (rAb). The activity of both wild type and Sortase A5 pentamutant proteins are Ca2+ dependent, therefore, Our Sortag-IT labeling buffers and reagents are formulated to contain Ca2+ for optimal protein labeling. In addition, our AbFlex recombinant antibodies are provided in HEPES buffer, which is does not bind Ca2+ and will not interfere with the Sortase A5 enzymatic activity.
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
Store at -80 degree C to prevent degradation and avoid repeated freeze/thaw cycles. This product is guaranteed for 6 months from date of arrival.
Shipping Temp: Dry Ice

Application Data

product-image-AAA59632_AD11.jpg Application Data

SDS-PAGE

(Sortase A5 has increased labeling efficiency compared to the Wild-Type sortase. The H3K9Ac AbFlex antibody (67 ug) was labeled with 5 ug Biotin (1.28 mM) using 1 ug Sortase A5 or Wild-Type sortase at 30 degree C for 2 hr. with shaking. Top Panel: Following purification, 0.25 and 0.125 ug of labeled antibodies were run on an SDS-PAGE PAGE gel and labeling was detected using streptavidin-HRP. Lanes 1 & 2: 0.25 ug and 0.125 ug of H3K9Ac AbFlex Ab labeled with wild-type Sortase, respectively. Lanes 3 & 4: 0.25 ug and 0.125 ug of H3K9Ac AbFlex Ab labeled with Sortase A5, respectively. Bottom panel: The intensity of the labeling was quantified using BioRad’s Gel Doc imaging system, represented here as arbitrary units.)

product-image-AAA59632_SDS_PAGE13.jpg SDS-PAGE (Sortase A5 has increased labeling efficiency compared to the Wild-Type sortase. The H3K9Ac AbFlex antibody (67 ug) was labeled with 5 ug Biotin (1.28 mM) using 1 ug Sortase A5 or Wild-Type sortase at 30 degree C for 2 hr. with shaking. Top Panel: Following purification, 0.25 and 0.125 ug of labeled antibodies were run on an SDS-PAGE PAGE gel and labeling was detected using streptavidin-HRP. Lanes 1 & 2: 0.25 ug and 0.125 ug of H3K9Ac AbFlex Ab labeled with wild-type Sortase, respectively. Lanes 3 & 4: 0.25 ug and 0.125 ug of H3K9Ac AbFlex Ab labeled with Sortase A5, respectively. Bottom panel: The intensity of the labeling was quantified using BioRad’s Gel Doc imaging system, represented here as arbitrary units.)

SDS-PAGE

(Sortase A5 protein gel. Sortase A5 run on an SDS-PAGE gel and stained with Coomassie Blue.)

product-image-AAA59632_SDS_PAGE15.jpg SDS-PAGE (Sortase A5 protein gel. Sortase A5 run on an SDS-PAGE gel and stained with Coomassie Blue.)
Related Product Information for Sortase A5 recombinant protein
Short Description: Sortag-IT Labeling Kits are designed for site-specific labeling of Our highly specific AbFlex recombinant antibodies (rAb) via the Sortase tag recognition sequence (LPXTG) that is incorporated into the heavy chains of each AbFlex antibody. Directly conjugate fluorophores, enzymes (HRP, AP), biotin, peptides, DNA, carbohydrates or other labels to the terminal end of the heavy chain to ensure the antigen binding site remains available for target recognition. The Sortag-IT Labeling Kits use Our Sortase A5 pentamutant from Staphylococcus aureus that is significantly more active than wild-type Sortase to provide a faster, more efficient labeling reaction. Simply add your AbFlex antibody with the poly-Glycine label, add Sortase A5 and incubate for approximately 1 hour. Purification columns are included to remove excess label and Stop Solution is provided to inactivate the Sortase A5 enzyme. Labeled antibodies are ready for downstream analysis or can be stored at 4C for up to 3 months.

Background: Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase A5 is an engineered pentamutant variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase. Sortase A5 site-specifically labels antibodies or proteins when the LPXTG recognition sequence is displayed. Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n (where n = 3 or more Glycine residues). Sortase A5 Pentamutant is covered by US patent number 9,267,127.
Product Categories/Family for Sortase A5 recombinant protein

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
17.8kDa

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Sortase A5 (Catalog #AAA59632) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MQAKPQIPKD KSKVAGYIEI PDADIKEPVY PGPATREQLN RGVSFAEENE SLDDQNISIA GHTFIDRPNY QFTNLKAAKK GSMVYFKVGN ETRKYKMTSI RNVKPTAVGV LDEQKGKDKQ LTLITCDDYN EETGVWETRK IFVATEVKLE HHHHHH. It is sometimes possible for the material contained within the vial of "Sortase A5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.