TATA-box-binding protein Recombinant Protein | SPT15 recombinant protein
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) (Baker's yeast) TATA-box-binding protein
Gene Names
SPT15; BTF1; TBP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TATA-box-binding protein; N/A; Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) (Baker's yeast) TATA-box-binding protein; SPT15 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-240aa; Full Length
Sequence
ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Sequence Length
240
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for SPT15 recombinant protein
General transcription factor that functions at the core of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.9 kDa
NCBI Official Full Name
TATA-binding protein
NCBI Official Symbol
SPT15
NCBI Official Synonym Symbols
BTF1; TBP1
NCBI Protein Information
TATA-binding protein
UniProt Protein Name
TATA-box-binding protein
UniProt Gene Name
SPT15
UniProt Synonym Gene Names
BTF1; TBP1; TBP
UniProt Entry Name
TBP_YEAST
Similar Products
Product Notes
The SPT15 spt15 (Catalog #AAA116042) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-240aa; Full Length. The amino acid sequence is listed below: ADEERLKEFK EANKIVFDPN TRQVWENQNR DGTKPATTFQ SEEDIKRAAP ESEKDTSATS GIVPTLQNIV ATVTLGCRLD LKTVALHARN AEYNPKRFAA VIMRIREPKT TALIFASGKM VVTGAKSEDD SKLASRKYAR IIQKIGFAAK FTDFKIQNIV GSCDVKFPIR LEGLAFSHGT FSSYEPELFP GLIYRMVKPK IVLLIFVSGK IVLTGAKQRE EIYQAFEAIY PVLSEFRKM. It is sometimes possible for the material contained within the vial of "TATA-box-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
