Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA196938_SDS_PAGE15.jpg SDS-PAGE (12% SDS-PAGE)

SREBF2 / Sterol Regulatory Element-Binding Protein 2 Recombinant Protein | SREBF2 recombinant protein

Human SREBF2 / Sterol Regulatory Element-Binding Protein 2 Recombinant Protein

Average rating 0.0
No ratings yet
Gene Names
SREBF2; SREBP2; bHLHd2; SREBP-2
Applications
Western Blot, ELISA
Purity
>90%
Synonyms
SREBF2 / Sterol Regulatory Element-Binding Protein 2; N/A; Human SREBF2 / Sterol Regulatory Element-Binding Protein 2 Recombinant Protein; Sterol regulatory element-binding protein 2; SREBP-2; Class D basic helix-loop-helix protein 2; bHLHd2; Sterol regulatory element-binding transcription factor 2; BHLHD2; SREBP2; SREBF2 recombinant protein
Ordering
Host
E. Coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% Glycerol (PH8.0)
Concentration
Reconstitution Dependent (varies by lot)
Sequence
RRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMNLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSP
Sequence Length
1141
Applicable Applications for SREBF2 recombinant protein
WB (Western Blot), ELISA
Species
Human
Tag
His
Organism
Homo sapiens (Human)
Subunit
Forms a tight complex with SCAP in the ER membrane. Efficient DNA binding of the soluble transcription factor fragment requires dimerization with another bHLH protein. Interacts with LMNA. Component of SCAP/SREBP complex composed of SREBF2, SCAP and RNF139; the complex hampers the interaction between SCAP and SEC24B, thereby reducing SREBF2 proteolytic processing. Interacts (via C-terminal domain) with RNF139.
Entry Function
Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway (By similarity). Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes.
Preparation and Storage
Store at -20°C. Avoid repeated freezing and thawing.

SDS-PAGE

(12% SDS-PAGE)

product-image-AAA196938_SDS_PAGE15.jpg SDS-PAGE (12% SDS-PAGE)
Related Product Information for SREBF2 recombinant protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
15.4 KD
NCBI Official Full Name
sterol regulatory element binding protein-2
NCBI Official Synonym Full Names
sterol regulatory element binding transcription factor 2
NCBI Official Symbol
SREBF2
NCBI Official Synonym Symbols
SREBP2; bHLHd2; SREBP-2
NCBI Protein Information
sterol regulatory element-binding protein 2
UniProt Protein Name
Sterol regulatory element-binding protein 2
UniProt Gene Name
SREBF2
UniProt Synonym Gene Names
BHLHD2; SREBP2; SREBP-2; bHLHd2
UniProt Entry Name
SRBP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SREBF2 srebf2 (Catalog #AAA196938) is a Recombinant Protein produced from E. Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SREBF2 / Sterol Regulatory Element-Binding Protein 2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the SREBF2 srebf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRTTHNIIEK RYRSSINDKI IELKDLVMGT DAKMHKSGVL RKAIDYIKYL QQVNHKLRQE NMNLKLANQK NKLLKGIDLG SLVDNEVDLK IEDFNQNVLL MSPPASDSGS QAGFSPYSID SEPGSPLLDD AKVKDEPDSP. It is sometimes possible for the material contained within the vial of "SREBF2 / Sterol Regulatory Element-Binding Protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.