SDS-PAGE
Tetanus toxin (tetX) Recombinant Protein | tetX recombinant protein
Recombinant Clostridium tetani Tetanus toxin (tetX), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tetanus toxin (tetX); N/A; Recombinant Clostridium tetani Tetanus toxin (tetX), partial; tetX recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
123-573. Partial-length
Sequence
SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTL
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for tetX recombinant protein
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.
Similar Products
Product Notes
The tetX (Catalog #AAA233481) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 123-573. Partial-length. The amino acid sequence is listed below: SLLDKFDTNS NSVSFNLLEQ DPSGATTKSA MLTNLIIFGP GPVLNKNEVR GIVLRVDNKN YFPCRDGFGS IMQMAFCPEY VPTFDNVIEN ITSLTIGKSK YFQDPALLLM HELIHVLHGL YGMQVSSHEI IPSKQEIYMQ HTYPISAEEL FTFGGQDANL ISIDIKNDLY EKTLNDYKAI ANKLSQVTSC NDPNIDIDSY KQIYQQKYQF DKDSNGQYIV NEDKFQILYN SIMYGFTEIE LGKKFNIKTR LSYFSMNHDP VKIPNLLDDT IYNDTEGFNI ESKDLKSEYK GQNMRVNTNA FRNVDGSGLV SKLIGLCKKI IPPTNIRENL YNRTASLTDL GGELCIKIKN EDLTFIAEKN SFSEEPFQDE IVSYNTKNKP LNFNYSLDKI IVDYNLQSKI TLPNDRTTPV TKGIPYAPEY KSNAASTIEI HNIDDNTIYQ YLYAQKSPTT L. It is sometimes possible for the material contained within the vial of "Tetanus toxin (tetX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.