Tight junction protein ZO-1 Recombinant Protein | TJP1 recombinant protein
Recombinant Dog Tight junction protein ZO-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tight junction protein ZO-1; N/A; Recombinant Dog Tight junction protein ZO-1; Tight junction protein 1; Zona occludens protein 1; Zonula occludens protein 1; TJP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1633-1769aa; Partial
Sequence
VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Sequence Length
1769
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for TJP1 recombinant protein
The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells.
References
Molecular characterization of the tight junction protein ZO-1 in MDCK cells.Gonzalez-Mariscal L., Islas S., Contreras R.G., Garcia-Villegas M.R., Betanzos A., Vega J., Diaz-Quinonez A., Martin-Orozco N., Ortiz-Navarrete V., Cereijido M., Valdes J.Exp. Cell Res. 248:97-109(1999) The heat-shock protein Apg-2 binds to the tight junction protein ZO-1 and regulates transcriptional activity of ZONAB.Tsapara A., Matter K., Balda M.S.Mol. Biol. Cell 17:1322-1330(2006)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.7 kDa
NCBI Official Full Name
tight junction protein ZO-1
UniProt Protein Name
Tight junction protein ZO-1
UniProt Gene Name
TJP1
UniProt Synonym Gene Names
ZO1
UniProt Entry Name
ZO1_CANLF
Similar Products
Product Notes
The TJP1 tjp1 (Catalog #AAA115923) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1633-1769aa; Partial. The amino acid sequence is listed below: VVATARGVFN NNGGVLSSIE TGVSIIIPQG AIPEGVEQEI YFKVCRDNSI LPPLDKEKGE TLLSPLVMCG PHGLKFLKPV ELRLPHCASM TPDGWSFALK SSDSSSGDPK TWQNKCLPGD PNYLVGANCV SVLIDHF. It is sometimes possible for the material contained within the vial of "Tight junction protein ZO-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
