Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116175_SDS_PAGE15.jpg SDS-PAGE

Tenascin (TNC) Recombinant Protein | TNC recombinant protein

Recombinant Human Tenascin (TNC), partial

Average rating 0.0
No ratings yet
Gene Names
TNC; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tenascin (TNC); N/A; Recombinant Human Tenascin (TNC), partial; Cytotactin; GMEM; GP 150-225; Glioma-associated-extracellular matrix antigen; Hexabrachion; JI; Myotendinous antigen; Neuronectin; Tenascin-C; TN-C; TNC recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1888-2201. Partial-length
Sequence
DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116175_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for TNC recombinant protein
Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.
Product Categories/Family for TNC recombinant protein
References
The complete cDNA sequence of human hexabrachion (Tenascin) . A multidomain protein containing unique epidermal growth factor repeats.Nies D.E., Hemesath T.J., Kim J.H., Gulcher J.R., Stefansson K.J. Biol. Chem. 266:2818-2823(1991) Human tenascin primary structure, pre-mRNA splicing patterns and localization of the epitopes recognized by two monoclonal antibodies.Siri A., Carnemolla B., Saginati M., Leprini A., Casari G., Baralle F., Zardi L.Nucleic Acids Res. 19:525-531(1991) Structure of the human hexabrachion (tenascin) gene.Gulcher J.R., Nies D.E., Alexakos M.J., Ravikant N.A., Sturgill M.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 88:9438-9442(1991) Human tenascin gene. Structure of the 5'-region, identification, and characterization of the transcription regulatory sequences.Gherzi R., Carnemolla B., Siri A., Ponassi M., Balza E., Zardi L.J. Biol. Chem. 270:3429-3434(1995) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004) Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes.Glumoff V., Savontaus M., Vehanen J., Vuorio E.Biochim. Biophys. Acta 1219:613-622(1994) An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592(1989) Binding of the NG2 proteoglycan to type VI collagen and other extracellular matrix molecules.Burg M.A., Tillet E., Timpl R., Stallcup W.B.J. Biol. Chem. 271:26110-26116(1996) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.Proteomics 8:3833-3847(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structure of a fibronectin type III domain from tenascin phased by MAD analysis of the selenomethionyl protein.Leahy D.J., Hendrickson W.A., Aukhil I., Erickson H.P.Science 258:987-991(1992) Exome sequencing and linkage analysis identified tenascin-C (TNC) as a novel causative gene in nonsyndromic hearing loss.Zhao Y., Zhao F., Zong L., Zhang P., Guan L., Zhang J., Wang D., Wang J., Chai W., Lan L., Li Q., Han B., Yang L., Jin X., Yang W., Hu X., Wang X., Li N., Li Y., Petit C., Wang J., Wang H.Y., Wang Q.PLoS ONE 8:E69549-E69549(2013)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.5 kDa
NCBI Official Full Name
tenascin
NCBI Official Synonym Full Names
tenascin C
NCBI Official Symbol
TNC
NCBI Official Synonym Symbols
GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
NCBI Protein Information
tenascin
UniProt Protein Name
Tenascin
UniProt Gene Name
TNC
UniProt Synonym Gene Names
HXB; TN; TN-C
UniProt Entry Name
TENA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TNC tnc (Catalog #AAA116175) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1888-2201. Partial-length. The amino acid sequence is listed below: DSPRDLTATE VQSETALLTW RPPRASVTGY LLVYESVDGT VKEVIVGPDT TSYSLADLSP STHYTAKIQA LNGPLRSNMI QTIFTTIGLL YPFPKDCSQA MLNGDTTSGL YTIYLNGDKA EALEVFCDMT SDGGGWIVFL RRKNGRENFY QNWKAYAAGF GDRREEFWLG LDNLNKITAQ GQYELRVDLR DHGETAFAVY DKFSVGDAKT RYKLKVEGYS GTAGDSMAYH NGRSFSTFDK DTDSAITNCA LSYKGAFWYR NCHRVNLMGR YGDNNHSQGV NWFHWKGHEH SIQFAEMKLR PSNFRNLEGR RKRA. It is sometimes possible for the material contained within the vial of "Tenascin (TNC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.