Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA117679_SDS_PAGE15.jpg SDS-PAGE

UTP--glucose-1-phosphate uridylyltransferase Recombinant Protein | UGP2 recombinant protein

Recombinant Human UTP--glucose-1-phosphate uridylyltransferase

Gene Names
UGP2; UDPG; UGP1; UDPGP; UGPP1; UGPP2; UDPGP2; pHC379
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UTP--glucose-1-phosphate uridylyltransferase; N/A; Recombinant Human UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; UGP2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497aa; Full Length of Isoform 2
Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA117679_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for UGP2 recombinant protein
Plays a central role as a glucosyl donor in cellular metabolic pathways.
Product Categories/Family for UGP2 recombinant protein
References
Cloning of a human liver UDP-glucose pyrophosphorylase cDNA by complementation of the bacterial galU mutation.Peng H.-L., Chang H.-Y.FEBS Lett. 329:153-158(1993) Sequence differences between human muscle and liver cDNAs for UDPglucose pyrophosphorylase and kinetic properties of the recombinant enzymes expressed in Escherichia coli.Duggleby R.G., Chao Y.C., Huang J.G., Peng H.-L., Chang H.-Y.Eur. J. Biochem. 235:173-179(1996) The importance of conserved residues in human liver UDPglucose pyrophosphorylase.Chang H.-Y., Peng H.-L., Chao Y.C., Duggleby R.G.Eur. J. Biochem. 236:723-728(1996) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.Yu Q., Zheng X.Biochem. J. 442:283-291(2012)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71.7 kDa
NCBI Official Full Name
UTP--glucose-1-phosphate uridylyltransferase isoform b
NCBI Official Synonym Full Names
UDP-glucose pyrophosphorylase 2
NCBI Official Symbol
UGP2
NCBI Official Synonym Symbols
UDPG; UGP1; UDPGP; UGPP1; UGPP2; UDPGP2; pHC379
NCBI Protein Information
UTP--glucose-1-phosphate uridylyltransferase
UniProt Protein Name
UTP--glucose-1-phosphate uridylyltransferase
UniProt Gene Name
UGP2
UniProt Synonym Gene Names
UGP1; UDPGP; UGPase
UniProt Entry Name
UGPA_HUMAN

Similar Products

Product Notes

The UGP2 ugp2 (Catalog #AAA117679) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497aa; Full Length of Isoform 2. The amino acid sequence is listed below: MSQDGASQFQ EVIRQELELS VKKELEKILT TASSHEFEHT KKDLDGFRKL FHRFLQEKGP SVDWGKIQRP PEDSIQPYEK IKARGLPDNI SSVLNKLVVV KLNGGLGTSM GCKGPKSLIG VRNENTFLDL TVQQIEHLNK TYNTDVPLVL MNSFNTDEDT KKILQKYNHC RVKIYTFNQS RYPRINKESL LPVAKDVSYS GENTEAWYPP GHGDIYASFY NSGLLDTFIG EGKEYIFVSN IDNLGATVDL YILNHLMNPP NGKRCEFVME VTNKTRADVK GGTLTQYEGK LRLVEIAQVP KAHVDEFKSV SKFKIFNTNN LWISLAAVKR LQEQNAIDME IIVNAKTLDG GLNVIQLETA VGAAIKSFEN SLGINVPRSR FLPVKTTSDL LLVMSNLYSL NAGSLTMSEK REFPTVPLVK LGSSFTKVQD YLRRFESIPD MLELDHLTVS GDVTFGKNVS LKGTVIIIAN HGDRIDIPPG AVLENKIVSG NLRILDH. It is sometimes possible for the material contained within the vial of "UTP--glucose-1-phosphate uridylyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.