Herpes Simplex Virus-2 gB Recombinant Protein | HSV-2 gB recombinant protein
Recombinant Herpes Simplex Virus-2 gB
Applications
Western Blot, ELISA
Purity
Protein is >90% pure as determined by SDS PAGE.
Synonyms
Herpes Simplex Virus-2 gB; N/A; Recombinant Herpes Simplex Virus-2 gB; HSV-2 gB; Herpes Simplex Virus-2 gB Recombinant; HSV-2 gB recombinant protein
Host
E Coli
Purity/Purification
Protein is >90% pure as determined by SDS PAGE.
Form/Format
(1 mg/mL) 10 mM Phosphate buffer pH 7.6; and 75 mM NaCl.
Sequence
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
Sequence Length
1066
Applicable Applications for HSV-2 gB recombinant protein
WB (Western Blot), ELISA
Physical Appearance
Sterile Filtered clear solution.
Preparation and Storage
HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Please prevent freeze thaw cycles.
Related Product Information for HSV-2 gB recombinant protein
The E Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).
Product Categories/Family for HSV-2 gB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
helicase-primase subunit
UniProt Protein Name
UL52 protein
UniProt Gene Name
UL52
UniProt Entry Name
A0A0C5B3L0_HHV2
Similar Products
Product Notes
The HSV-2 gB ul52 (Catalog #AAA38013) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Herpes Simplex Virus-2 gB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the HSV-2 gB ul52 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIAPYKFKAT MYYKDVTVSQ VWFGHRYSQF MGIFEDRAPV PFEEVIDKIN AKGVCRST AKYVRNNLET TAFHRDDHET DMELKPANAA TRTSRGWHTT DLKYNPSRVE AFHRYGTTVN CIVEEVDARS VYPYDEFVLA TGDFVYMSPF YGYREGSHTE HTSYAADRFK QVDGFYARDL TTKARATAPT TRNLLTTPKF TVAWDWVPKR PSVCTHHHHH H.. It is sometimes possible for the material contained within the vial of "Herpes Simplex Virus-2 gB, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.