Recombination protein uvsY (uvsY) Recombinant Protein | uvsY recombinant protein
Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)
Gene Names
                                                    uvsY; fdsB
                                                Purity
                                                    Greater or equal to 85% purity as determined by SDS-PAGE.
                                                Synonyms
                                            Recombination protein uvsY (uvsY); N/A; Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY); Enterobacteria phage T4 (Bacteriophage T4); uvsY recombinant protein
                                        
                    Host                
                
                    E Coli or Yeast or Baculovirus or Mammalian Cell                
            
                    Purity/Purification                
                
                    Greater or equal to 85% purity as determined by SDS-PAGE.                
            
                    Form/Format                
                
                    Lyophilized or liquid (Format to be determined during the manufacturing process)                
            
                    Sequence Positions                
                
                    1-137aa; Full Length                
            
                    Sequence                
                
                    MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
                
            
                        Species                    
                    
                        Enterobacteria phage T4 (Bacteriophage T4)                    
                
                    Preparation and Storage                
                
                    Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.                
            
                    Related Product Information for uvsY recombinant protein                
                
                 
                    Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.                 
                
            
                    References                
                
                    "Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units."
Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G.
Virology 184:359-369(1991)                
            NCBI and Uniprot Product Information
                    NCBI GI #                
                
            
                    NCBI GeneID                
                
            
                    NCBI Accession #                
                
            
                    NCBI GenBank Nucleotide #                
                
            
                    UniProt Accession #                
                
            
                    Molecular Weight                
                
                                            31.8 kDa                                    
            
                    NCBI Official Full Name                
                
                    UvsY recombination, repair and ssDNA binding protein                
            
                    NCBI Official Symbol                
                
                    uvsY                 
            
                    NCBI Official Synonym Symbols                
                
                    fdsB                 
            
                    NCBI Protein Information                
                
                    recombination protein; facilitates UvsX and inhibitor of EndoVII                
            
                    UniProt Protein Name                
                
                    Recombination protein uvsY                
            
                    UniProt Gene Name                
                
                    uvsY                
            
                    UniProt Entry Name                
                
                    UVSY_BPT4                
            Similar Products
Product Notes
The uvsY uvsy (Catalog #AAA18553) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-137aa; Full Length. The amino acid sequence is listed below: MRLEDLQEEL KKDVFIDSTK LQYEAANNVM LYSKWLNKHS SIKKEMLRIE AQKKVALKAR LDYYSGRGDG DEFSMDRYEK SEMKTVLSAD KDVLKVDTSL QYWGILLDFC SGALDAIKSR GFAIKHIQDM RAFEAGK . It is sometimes possible for the material contained within the vial of "Recombination protein uvsY (uvsY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.

 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                