Protein Vpx Recombinant Protein | vpx recombinant protein
Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Vpx; N/A; Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx; Viral protein X; X ORF protein; vpx recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-113aa; Full Length
Sequence
MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for vpx recombinant protein
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
References
A novel proviral clone of HIV-2 biological and phylogenetic relationship to other primate immunodeficiency viruses.Kirchhoff F., Jentsch K., Bachmann B., Stuke A., Laloux C., Lueke W., Stahl-Henning C., Schneider J., Nieselt K., Eigen M., Hunsmann G.Virology 177:305-311(1990) The human immunodeficiency virus type 2 Vpx protein usurps the CUL4A-DDB1 DCAF1 ubiquitin ligase to overcome a postentry block in macrophage infection.Bergamaschi A., Ayinde D., David A., Le Rouzic E., Morel M., Collin G., Descamps D., Damond F., Brun-Vezinet F., Nisole S., Margottin-Goguet F., Pancino G., Transy C.J. Virol. 83:4854-4860(2009) AIDS/HIV. HIV interplay with SAMHD1.Schaller T., Goujon C., Malim M.H.Science 335:1313-1314(2012) The Vpx lentiviral accessory protein targets SAMHD1 for degradation in the nucleus.Hofmann H., Logue E.C., Bloch N., Daddacha W., Polsky S.B., Schultz M.L., Kim B., Landau N.R.J. Virol. 86:12552-12560(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.2 kDa
NCBI Official Full Name
vpx protein
NCBI Official Symbol
HIV2gp3
NCBI Protein Information
vpx protein
UniProt Protein Name
Protein Vpx
UniProt Gene Name
vpx
UniProt Entry Name
VPX_HV2BE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The vpx vpx (Catalog #AAA115781) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-113aa; Full Length. The amino acid sequence is listed below: MTDPRERVPP GNSGEETIGE AFEWLERTIE ALNREAVNHL PRELIFQVWQ RSWRYWHDEQ GMSASYTKYR YLCLMQKAIF THFKRGCTCW GEDMGREGLE DQGPPPPPPP GLV. It is sometimes possible for the material contained within the vial of "Protein Vpx, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
