Loading...

Skip to main content
SDS-PAGE

Protein Vpx Recombinant Protein | vpx recombinant protein

Recombinant Simian immunodeficiency virus Protein Vpx (Vpx)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Vpx; N/A; Recombinant Simian immunodeficiency virus Protein Vpx (Vpx); Viral protein X; X ORF protein; vpx recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-112aa; Full Length
Sequence
MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for vpx recombinant protein
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
References
Sequence analysis and acute pathogenicity of molecularly cloned SIVSMM-PBj14.Dewhurst S., Embretson J.E., Anderson D.C., Mullins J.I., Fultz P.N.Nature 345:636-640(1990) Molecular clones from a non-acutely pathogenic derivative of SIVsmmPBj14 characterization and comparison to acutely pathogenic clones.Dewhurst S., Embretson J.E., Fultz P.N., Mullins J.I.AIDS Res. Hum. Retroviruses 8:1179-1187(1992) The human immunodeficiency virus type 2 Vpx protein usurps the CUL4A-DDB1 DCAF1 ubiquitin ligase to overcome a postentry block in macrophage infection.Bergamaschi A., Ayinde D., David A., Le Rouzic E., Morel M., Collin G., Descamps D., Damond F., Brun-Vezinet F., Nisole S., Margottin-Goguet F., Pancino G., Transy C.J. Virol. 83:4854-4860(2009) Structural basis of lentiviral subversion of a cellular protein degradation pathway.Schwefel D., Groom H.C., Boucherit V.C., Christodoulou E., Walker P.A., Stoye J.P., Bishop K.N., Taylor I.A.Nature 505:234-238(2014)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
28.9 kDa
NCBI Official Full Name
Protein Vpx
UniProt Protein Name
Protein Vpx
UniProt Gene Name
vpx
UniProt Entry Name
VPX_SIVSP

Similar Products

Product Notes

The vpx vpx (Catalog #AAA18697) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-112aa; Full Length. The amino acid sequence is listed below: MSDPRERIPP GNSGEETIGE AFDWLDRTVE EINRAAVNHL PRELIFQVWR RSWEYWHDEM GMSVSYTKYR YLCLIQKAMF MHCKKGCRCL GGEHGAGGWR PGPPPPPPPG LA . It is sometimes possible for the material contained within the vial of "Protein Vpx, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.