Serine/threonine-protein kinase VRK1 (Vrk1) Recombinant Protein | Vrk1 recombinant protein
Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1)
Gene Names
Vrk1; 51PK
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase VRK1 (Vrk1); N/A; Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1); Serine/threonine-protein kinase VRK1; EC=2.7.11.1; Serine/threonine-protein kinase 51PK; Vaccinia-related kinase 1; Vrk1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-440aa; Full Length
Sequence
MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Vrk1 recombinant protein
Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity
Product Categories/Family for Vrk1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55.2 kDa
NCBI Official Full Name
serine/threonine-protein kinase VRK1 isoform b
NCBI Official Synonym Full Names
vaccinia related kinase 1
NCBI Official Symbol
Vrk1
NCBI Official Synonym Symbols
51PK
NCBI Protein Information
serine/threonine-protein kinase VRK1; vaccinia-related kinase 1; serine/threonine-protein kinase 51PK
UniProt Protein Name
Serine/threonine-protein kinase VRK1
UniProt Gene Name
Vrk1
UniProt Entry Name
VRK1_MOUSE
Similar Products
Product Notes
The Vrk1 vrk1 (Catalog #AAA116942) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-440aa; Full Length. The amino acid sequence is listed below: MPRVKAAQAG RPGPAKRRLA EQFAAGEVLT DMSRKEWKLG LPIGQGGFGC IYLADTNSSK PVGSDAPCVV KVEPSDNGPL FTELKFYQRA AKPEQIQKWI RTHKLKYLGV PKYWGSGLHD KNGKSYRFMI MDRFGSDLQK IYEANAKRFS RKTVLQLSLR ILDILEYIHE HEYVHGDIKA SNLLLSHKNP DQVYLVDYGL AYRYCPDGVH KEYKEDPKRC HDGTLEFTSI DAHKGVAPSR RGDLEILGYC MIQWLSGCLP WEDNLKDPNY VRDSKIRYRD NVAALMEKCF PEKNKPGEIA KYMESVKLLE YTEKPLYQNL RDILLQGLKA IGSKDDGKLD FSAVENGSVK TRPASKKRKK EAEESAVCAV EDMECSDTQV QEAAQTRSVE SQGAIHGSMS QPAAGCSSSD SSRRQQHLGL EQDMLRLDRR GSRTRKKAQK. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase VRK1 (Vrk1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
