SDS-PAGE
(Recombinant Human WAP5/WFDC2/HE4 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 19 kDa and 23-25 kDa.)
WAP5/WFDC2/HE4 Recombinant Protein | WAP5 recombinant protein
Recombinant Human WAP5/WFDC2/HE4 Protein
Gene Names
WFDC2; HE4; WAP5; EDDM4; dJ461P17.6
Purity
>95% by SDS-PAGE.
Synonyms
WAP5/WFDC2/HE4; N/A; Recombinant Human WAP5/WFDC2/HE4 Protein; dJ461P17.6; EDDM4; HE4; WAP5; WAP5 recombinant protein
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Sequence Length
124
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method
Tag
C-his
Reconstitution
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Preparation and Storage
Store the lyophilized protein at -20°C to -80°C for long term.
After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Avoid repeated freeze/thaw cycles.
After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Avoid repeated freeze/thaw cycles.
SDS-PAGE
(Recombinant Human WAP5/WFDC2/HE4 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 19 kDa and 23-25 kDa.)
SDS-PAGE
(Recombinant Human WAP5/WFDC2/HE4 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 19 kDa and 23-25 kDa.)
Related Product Information for WAP5 recombinant protein
Description: Recombinant Human WAP5/WFDC2/HE4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu31-Phe124) of human WAP5/WFDC2/HE4 (Accession #NP_006094.3) fused with a 6xHis tag at the C-terminus.
Background: The protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
Background: The protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
Product Categories/Family for WAP5 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
WAP four-disulfide core domain protein 2
NCBI Official Synonym Full Names
WAP four-disulfide core domain 2
NCBI Official Symbol
WFDC2
NCBI Official Synonym Symbols
HE4; WAP5; EDDM4; dJ461P17.6
NCBI Protein Information
WAP four-disulfide core domain protein 2
UniProt Protein Name
WAP four-disulfide core domain protein 2
UniProt Gene Name
WFDC2
UniProt Synonym Gene Names
HE4; WAP5
UniProt Entry Name
WFDC2_HUMAN
Similar Products
Product Notes
The WAP5 wfdc2 (Catalog #AAA281431) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EKTGVCPELQ ADQNCTQECV SDSECADNLK CCSAGCATFC SLPNDKEGSC PQVNINFPQL GLCRDQCQVD SQCPGQMKCC RNGCGKVSCV TPNF. It is sometimes possible for the material contained within the vial of "WAP5/WFDC2/HE4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.