Xaa-Pro aminopeptidase 1 Recombinant Protein | XPNPEP1 recombinant protein
Recombinant Human Xaa-Pro aminopeptidase 1
Gene Names
XPNPEP1; APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Xaa-Pro aminopeptidase 1; N/A; Recombinant Human Xaa-Pro aminopeptidase 1; Aminoacylproline aminopeptidase; Cytosolic aminopeptidase P; Soluble aminopeptidase P; sAmp; X-Pro aminopeptidase 1; X-prolyl aminopeptidase 1, soluble; XPNPEP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-623aa; Full Length of Mature Protein
Sequence
PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
Sequence Length
642
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for XPNPEP1 recombinant protein
Contributes to the degradation of bradykinin. Catalyzes the roval of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
Product Categories/Family for XPNPEP1 recombinant protein
References
Isolation and sequence analysis of a human cDNA clone (XPNPEPL)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85.8 kDa
NCBI Official Full Name
xaa-Pro aminopeptidase 1 isoform 2
NCBI Official Synonym Full Names
X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
NCBI Official Symbol
XPNPEP1
NCBI Official Synonym Symbols
APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1
NCBI Protein Information
xaa-Pro aminopeptidase 1
UniProt Protein Name
Xaa-Pro aminopeptidase 1
UniProt Gene Name
XPNPEP1
UniProt Synonym Gene Names
sAmp
UniProt Entry Name
XPP1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The XPNPEP1 xpnpep1 (Catalog #AAA117401) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-623aa; Full Length of Mature Protein. The amino acid sequence is listed below: PPKVTSELLR QLRQAMRNSE YVTEPIQAYI IPSGDAHQSE YIAPCDCRRA FVSGFDGSAG TAIITEEHAA MWTDGRYFLQ AAKQMDSNWT LMKMGLKDTP TQEDWLVSVL PEGSRVGVDP LIIPTDYWKK MAKVLRSAGH HLIPVKENLV DKIWTDRPER PCKPLLTLGL DYTGISWKDK VADLRLKMAE RNVMWFVVTA LDEIAWLFNL RGSDVEHNPV FFSYAIIGLE TIMLFIDGDR IDAPSVKEHL LLDLGLEAEY RIQVHPYKSI LSELKALCAD LSPREKVWVS DKASYAVSET IPKDHRCCMP YTPICIAKAV KNSAESEGMR RAHIKDAVAL CELFNWLEKE VPKGGVTEIS AADKAEEFRR QQADFVDLSF PTISSTGPNG AIIHYAPVPE TNRTLSLDEV YLIDSGAQYK DGTTDVTRTM HFGTPTAYEK ECFTYVLKGH IAVSAAVFPT GTKGHLLDSF ARSALWDSGL DYLHGTGHGV GSFLNVHEGP CGISYKTFSD EPLEAGMIVT DEPGYYEDGA FGIRIENVVL VVPVKTKYNF NNRGSLTFEP LTLVPIQTKM IDVDSLTDKE CDWLNNYHLT CRDVIGKELQ KQGRQEALEW LIRETQPISK QH. It is sometimes possible for the material contained within the vial of "Xaa-Pro aminopeptidase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
