Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279216_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2?g/mL can bind Anti-IL6 recombinant antibody, the EC50 is 35.80-41.82 ng/mL)

Interleukin-6 (IL6) Active Protein | IL6 active protein

Recombinant Human Interleukin-6 (IL6)(Active)

Average rating 0.0
No ratings yet
Gene Names
IL6; HGF; HSF; BSF2; IL-6; IFNB2
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Interleukin-6 (IL6); N/A; Recombinant Human Interleukin-6 (IL6)(Active); IFNB2; IL6 active protein
Ordering
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Sequence Positions
30-212aa; Full Length of Mature Protein
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM$
Species
Homo sapiens (Human)
Tag
N-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2 ug/mL can bind Anti-IL6 recombinant antibody. The EC50 is 35.80-41.82 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2?g/mL can bind Anti-IL6 recombinant antibody, the EC50 is 35.80-41.82 ng/mL)

product-image-AAA279216_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2?g/mL can bind Anti-IL6 recombinant antibody, the EC50 is 35.80-41.82 ng/mL)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279216_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for IL6 active protein
Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism.
Product Categories/Family for IL6 active protein
References
"Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin."Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Kishimoto T.Nature 324:73-76 (1986)"Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene."Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T.EMBO J. 6:2939-2945 (1987)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
212
NCBI Official Full Name
Interleukin-6
NCBI Official Synonym Full Names
interleukin 6
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
HGF; HSF; BSF2; IL-6; IFNB2
NCBI Protein Information
interleukin-6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; interferon, beta 2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor
UniProt Protein Name
Interleukin-6
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL6 il6 (Catalog #AAA279216) is an Active Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-212aa; Full Length of Mature Protein. The amino acid sequence is listed below: VPPGEDSKDV AAPHRQPLTS SERIDKQIRY ILDGISALRK ETCNKSNMCE SSKEALAENN LNLPKMAEKD GCFQSGFNEE TCLVKIITGL LEFEVYLEYL QNRFESSEEQ ARAVQMSTKV LIQFLQKKAK NLDAITTPDP TTNASLLTKL QAQNQWLQDM TTHLILRSFK EFLQSSLRAL RQM$. It is sometimes possible for the material contained within the vial of "Interleukin-6 (IL6), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.