Interleukin-6 (IL6) Active Protein | IL6 active protein
Recombinant Human Interleukin-6 (IL6)(Active)
Gene Names
IL6; HGF; HSF; BSF2; IL-6; IFNB2
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Interleukin-6 (IL6); N/A; Recombinant Human Interleukin-6 (IL6)(Active); IFNB2; IL6 active protein
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Sequence Positions
30-212aa; Full Length of Mature Protein
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM$
Species
Homo sapiens (Human)
Tag
N-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2 ug/mL can bind Anti-IL6 recombinant antibody. The EC50 is 35.80-41.82 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Related Product Information for IL6 active protein
Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism.
Product Categories/Family for IL6 active protein
References
"Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin."Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Kishimoto T.Nature 324:73-76 (1986)"Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene."Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T.EMBO J. 6:2939-2945 (1987)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
212
NCBI Official Full Name
Interleukin-6
NCBI Official Synonym Full Names
interleukin 6
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
HGF; HSF; BSF2; IL-6; IFNB2
NCBI Protein Information
interleukin-6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; interferon, beta 2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor
UniProt Protein Name
Interleukin-6
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN
Similar Products
Product Notes
The IL6 il6 (Catalog #AAA279216) is an Active Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-212aa; Full Length of Mature Protein. The amino acid sequence is listed below: VPPGEDSKDV AAPHRQPLTS SERIDKQIRY ILDGISALRK ETCNKSNMCE SSKEALAENN LNLPKMAEKD GCFQSGFNEE TCLVKIITGL LEFEVYLEYL QNRFESSEEQ ARAVQMSTKV LIQFLQKKAK NLDAITTPDP TTNASLLTKL QAQNQWLQDM TTHLILRSFK EFLQSSLRAL RQM$. It is sometimes possible for the material contained within the vial of "Interleukin-6 (IL6), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
