Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279248_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 ?g/mL can bind Anti-LY6G6D recombinant antibody . The EC50 is 1.159-2.305 ?g/mL.)

Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) Active Protein | Ly6g6d active protein

Recombinant Mouse Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d)(Active)

Average rating 0.0
No ratings yet
Gene Names
Ly6g6d; G6d; G6f; NG25; NG32; MEGT1; A930024F17Rik
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d); N/A; Recombinant Mouse Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d)(Active); Ng25; Ly6g6d active protein
Ordering
Host
Yeast
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Sequence Positions
20-108aa; Full Length of Mature Protein
Sequence
HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN$
Species
Mus musculus (Mouse)
Tag
N-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Immunology
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 ug/mL can bind Anti-LY6G6D recombinant antibody. The EC50 is 1.159-2.305 ug/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 ?g/mL can bind Anti-LY6G6D recombinant antibody . The EC50 is 1.159-2.305 ?g/mL.)

product-image-AAA279248_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 ?g/mL can bind Anti-LY6G6D recombinant antibody . The EC50 is 1.159-2.305 ?g/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279248_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for Ly6g6d active protein
References
"Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms."Mallya M., Campbell R.D., Aguado B.Genomics 80:113-123 (2002)"Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.Genome Res. 13:2621-2636 (2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,092 Da
NCBI Official Full Name
lymphocyte antigen 6 complex locus protein G6d
NCBI Official Synonym Full Names
lymphocyte antigen 6 complex, locus G6D
NCBI Official Symbol
Ly6g6d
NCBI Official Synonym Symbols
G6d; G6f; NG25; NG32; MEGT1; A930024F17Rik
NCBI Protein Information
lymphocyte antigen 6 complex locus protein G6d; megakaryocyte-enhanced gene transcript 1
UniProt Protein Name
Lymphocyte antigen 6 complex locus protein G6d
UniProt Gene Name
Ly6g6d
UniProt Synonym Gene Names
Ng25
UniProt Entry Name
LY66D_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Ly6g6d ly6g6d (Catalog #AAA279248) is an Active Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-108aa; Full Length of Mature Protein. The amino acid sequence is listed below: HRTRCYDCGG GPSNSCKQTV ITCGEGERCG FLDRKPQPSS EQAKQPSATL SHHYPACVAT HHCNQVAIES VGDVTFTTQK NCCFGDLCN$. It is sometimes possible for the material contained within the vial of "Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.