Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Mucin-2 (MUC2) Recombinant Protein | MUC2 recombinant protein

Recombinant Human Mucin-2 (MUC2), partial

Gene Names
MUC2; MLP; SMUC; MUC-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucin-2 (MUC2); Recombinant Human Mucin-2 (MUC2); partial; Intestinal mucin-2; MUC2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-240aa; partial
Sequence
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MUC2 recombinant protein
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Product Categories/Family for MUC2 recombinant protein
References
Molecular cloning of human intestinal mucin (MUC2) cDNA. Identification of the amino terminus and overall sequence similarity to prepro-von Willebrand factor.Gum J.R. Jr., Hicks J.W., Toribara N.W., Siddiki B., Kim Y.S.J. Biol. Chem. 269:2440-2446(1994) The human MUC2 intestinal mucin has cysteine-rich subdomains located both upstream and downstream of its central repetitive region.Gum J.R. Jr., Hicks J.W., Toribara N.W., Rothe E.-M., Lagace R.E., Kim Y.S.J. Biol. Chem. 267:21375-21383(1992) MUC-2 human small intestinal mucin gene structure. Repeated arrays and polymorphism.Toribara N.W., Gum J.R. Jr., Culhane P.J., Lagace R.E., Hicks J.W., Petersen G.M., Kim Y.S.J. Clin. Invest. 88:1005-1013(1991) Molecular cloning of human intestinal mucin cDNAs. Sequence analysis and evidence for genetic polymorphism.Gum J.R. Jr., Byrd J.C., Hicks J.W., Toribara N.W., Lamport D.T.A., Kim Y.S.J. Biol. Chem. 264:6480-6487(1989) Human intestinal mucin-like protein (MLP) is homologous with rat MLP in the C-terminal region, and is encoded by a gene on chromosome 11 p 15.5.Xu G., Huan L., Khatri I., Sajjan U.S., McCool D., Wang D., Jones C., Forstner G., Forstner J.Biochem. Biophys. Res. Commun. 183:821-828(1992) In vivo glycosylation of mucin tandem repeats.Silverman H.S., Parry S., Sutton-Smith M., Burdick M.D., McDermott K., Reid C.J., Batra S.K., Morris H.R., Hollingsworth M.A., Dell A., Harris A.Glycobiology 11:459-471(2001) The N terminus of the MUC2 mucin forms trimers that are held together within a trypsin-resistant core fragment.Godl K., Johansson M.E.V., Lidell M.E., Moergelin M., Karlsson H., Olson F.J., Gum J.R. Jr., Kim Y.S., Hansson G.C.J. Biol. Chem. 277:47248-47256(2002) An autocatalytic cleavage in the C terminus of the human MUC2 mucin occurs at the low pH of the late secretory pathway.Lidell M.E., Johansson M.E.V., Hansson G.C.J. Biol. Chem. 278:13944-13951(2003) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) The protein disulfide isomerase AGR2 is essential for production of intestinal mucus.Park S.-W., Zhen G., Verhaeghe C., Nakagami Y., Nguyenvu L.T., Barczak A.J., Killeen N., Erle D.J.Proc. Natl. Acad. Sci. U.S.A. 106:6950-6955(2009) Proteomic analyses of the two mucus layers of the colon barrier reveal that their main component, the Muc2 mucin, is strongly bound to the Fcgbp protein.Johansson M.E.V., Thomsson K.A., Hansson G.C.J. Proteome Res. 8:3549-3557(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.8 kDa
NCBI Official Full Name
mucin-2
NCBI Official Synonym Full Names
mucin 2, oligomeric mucus/gel-forming
NCBI Official Symbol
MUC2
NCBI Official Synonym Symbols
MLP; SMUC; MUC-2
NCBI Protein Information
mucin-2
UniProt Protein Name
Mucin-2
UniProt Gene Name
MUC2
UniProt Synonym Gene Names
SMUC; MUC-2
UniProt Entry Name
MUC2_HUMAN

Similar Products

Product Notes

The MUC2 muc2 (Catalog #AAA18472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-240aa; partial. The amino acid sequence is listed below: VCSTWGNFHY KTFDGDVFRF PGLCDYNFAS DCRGSYKEFA VHLKRGPGQA EAPAGVESIL LTIKDDTIYL TRHLAVLNGA VVSTPHYSPG LLIEKSDAYT KVYSRAGLTL MWNREDALML ELDTKFRNHT CGLCGDYNGL QSYSEFLSDG VLFSPLEFGN MQKINQPDVV CEDPEEEVAP ASCSEHRAEC ERLLTAEAFA DCQDL . It is sometimes possible for the material contained within the vial of "Mucin-2 (MUC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.