SDS-PAGE
Arylacetamide deacetylase (AADAC) Recombinant Protein | AADAC recombinant protein
Recombinant Human Arylacetamide deacetylase (AADAC), partial
Gene Names
AADAC; DAC; CES5A1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arylacetamide deacetylase (AADAC); Recombinant Human Arylacetamide deacetylase (AADAC); partial; Arylacetamide deacetylase; EC=3.1.1.3; AADAC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-399aa; Partial
Sequence
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for AADAC recombinant protein
Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45.6
NCBI Official Full Name
arylacetamide deacetylase
NCBI Official Synonym Full Names
arylacetamide deacetylase
NCBI Official Symbol
AADAC
NCBI Official Synonym Symbols
DAC; CES5A1
NCBI Protein Information
arylacetamide deacetylase; arylacetamide deacetylase (esterase)
UniProt Protein Name
Arylacetamide deacetylase
UniProt Gene Name
AADAC
UniProt Synonym Gene Names
DAC
UniProt Entry Name
AAAD_HUMAN
Similar Products
Product Notes
The AADAC aadac (Catalog #AAA18495) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-399aa; Partial. The amino acid sequence is listed below: PDNVEEPWRM MWINAHLKTI QNLATFVELL GLHHFMDSFK VVGSFDEVPP TSDENVTVTE TKFNNILVRV YVPKRKSEAL RRGLFYIHGG GWCVGSAALS GYDLLSRWTA DRLDAVVVST NYRLAPKYHF PIQFEDVYNA LRWFLRKKVL AKYGVNPERI GISGDSAGGN LAAAVTQQLL DDPDVKIKLK IQSLIYPALQ PLDVDLPSYQ ENSNFLFLSK SLMVRFWSEY FTTDRSLEKA MLSRQHVPVE SSHLFKFVNW SSLLPERFIK GHVYNNPNYG SSELAKKYPG FLDVRAAPLL ADDNKLRGLP LTYVITCQYD LLRDDGLMYV TRLRNTGVQV THNHVEDGFH GAFSFLGLKI SHRLINQYIE WLKENL . It is sometimes possible for the material contained within the vial of "Arylacetamide deacetylase (AADAC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
