<
IHC (Immunohistchemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using TAP2 antibody at dilution of 1:200 (x400 lens).)
Rabbit TAP2 Polyclonal Antibody | anti-TAP2 antibody
TAP2 Rabbit anti-Human Polyclonal Antibody
Gene Names
TAP2; APT2; PSF2; ABC18; ABCB3; PSF-2; RING11; D6S217E
Reactivity
Mouse, Rat, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
TAP2; Polyclonal Antibody; TAP2 Rabbit anti-Human Polyclonal Antibody; IHC-plus TAP2 Antibody; ABC transporter; MHC 2; ABCB3; APT2; Antigen peptide transporter 2; D6S217E; ABC18; Ham2; Peptide supply factor 2; Peptide transporter PSF2; Peptide transporter TAP2; PSF2; Y1; PSF-2; RING11; anti-TAP2 antibody
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human TAP2
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
0.83mg/ml (varies by lot)
Applicable Applications for anti-TAP2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IF: 1:50-1:200
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 72kDa/75kDa, while the observed MW by Western blot was 76kDa.
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 72kDa/75kDa, while the observed MW by Western blot was 76kDa.
Target
Human TAP2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 430-680 of human TAP2 (NP_000535.3). YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQAVQRAHQILVLQEGKL
Conjugation
Unconjugated
Family
Transporter
Subfamily
ATP-binding cassette-ABCB/MDR
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.
IHC (Immunohistchemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistchemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded rat kidney using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistochemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistochemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistochemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded human rectal cancer using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistochemistry)
(TAP2 Antibody-Immunohistochemistry of paraffin-embedded human rectal cancer using TAP2 antibody at dilution of 1:200 (x400 lens).)
IHC (Immunohistochemistry)
(TAP2 Antibody-Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohistochemistry)
(TAP2 Antibody-Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE))
WB (Western Blot)
(TAP2 Antibody-Western blot analysis of extracts of various cell lines, using TAP2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)
WB (Western Blot)
(TAP2 Antibody-Western blot analysis of extracts of various cell lines, using TAP2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)
ICC (Immunocytochemistry)
(TAP2 Antibody-Immunofluorescence analysis of U2OS cells using TAP2 antibody. Blue: DAPI for nuclear staining.)
ICC (Immunocytochemistry)
(TAP2 Antibody-Immunofluorescence analysis of U2OS cells using TAP2 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-TAP2 antibody
TAP2 antibody is an unconjugated rabbit polyclonal antibody to TAP2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72,003 Da
NCBI Official Full Name
antigen peptide transporter 2 isoform 1
NCBI Official Synonym Full Names
transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
NCBI Official Symbol
TAP2
NCBI Official Synonym Symbols
APT2; PSF2; ABC18; ABCB3; PSF-2; RING11; D6S217E
NCBI Protein Information
antigen peptide transporter 2
UniProt Protein Name
Antigen peptide transporter 2
UniProt Gene Name
TAP2
UniProt Synonym Gene Names
ABCB3; PSF2; RING11; Y1; APT2; PSF-2
UniProt Entry Name
TAP2_HUMAN
Similar Products
Product Notes
The TAP2 tap2 (Catalog #AAA21306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAP2 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAP2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IF: 1:50-1:200 IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 72kDa/75kDa, while the observed MW by Western blot was 76kDa. Researchers should empirically determine the suitability of the TAP2 tap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
