Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mlPositive Control: 293T cells lysate)

Rabbit anti-Human PRDM9 Polyclonal Antibody | anti-PRDM9 antibody

PRDM9 antibody - middle region

Gene Names
PRDM9; PFM6; KMT8B; MSBP3; ZNF899; MEISETZ
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PRDM9, Antibody; PRDM9 antibody - middle region; anti-PRDM9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
Sequence Length
894
Applicable Applications for anti-PRDM9 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mlPositive Control: 293T cells lysate)

WB (Western Blot) (WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mlPositive Control: 293T cells lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PRDM9Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PRDM9Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PRDM9Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PRDM9Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PRDM9Sample Type: 293TAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PRDM9Sample Type: 293TAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PRDM9Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PRDM9Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PRDM9 AntibodyParaffin Embedded Tissue: Human PlacentaAntibody Concentration: 5 ug/ml)

IHC (Immunohistochemistry) (Rabbit Anti-PRDM9 AntibodyParaffin Embedded Tissue: Human PlacentaAntibody Concentration: 5 ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human TestisAnti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry) (Sample Type: Human TestisAnti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: Human TestisAnti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry) (Sample Type: Human TestisAnti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-PRDM9 antibody
This is a rabbit polyclonal antibody against PRDM9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation.The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 [PubMed 10668202]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
histone-lysine N-methyltransferase PRDM9 isoform PRDM9 B
NCBI Official Synonym Full Names
PR/SET domain 9
NCBI Official Symbol
PRDM9
NCBI Official Synonym Symbols
PFM6; KMT8B; MSBP3; ZNF899; MEISETZ
NCBI Protein Information
histone-lysine N-methyltransferase PRDM9
UniProt Protein Name
Histone-lysine N-methyltransferase PRDM9
UniProt Gene Name
PRDM9
UniProt Synonym Gene Names
PFM6
UniProt Entry Name
PRDM9_HUMAN

Similar Products

Product Notes

The PRDM9 prdm9 (Catalog #AAA23451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDM9 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM9 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PRDM9 prdm9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPGDQNQEQQ YPDPHSRNDK TKGQEIKERS KLLNKRTWQR EISRAFSSPP. It is sometimes possible for the material contained within the vial of "PRDM9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.