Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-PANX1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit PANX1 Polyclonal Antibody | anti-PANX1 antibody

PANX1 antibody - middle region

Gene Names
PANX1; PX1; MRS1; UNQ2529
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PANX1; Polyclonal Antibody; PANX1 antibody - middle region; anti-PANX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN
Sequence Length
426
Applicable Applications for anti-PANX1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 83%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PANX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PANX1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot) (WB Suggested Anti-PANX1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(p>Host: RabbitTarget Name: PANX1Sample Type: Human Jurkat cell lysateAntibody Dilution: 1.0 ug/ml)

WB (Western Blot) (p>Host: RabbitTarget Name: PANX1Sample Type: Human Jurkat cell lysateAntibody Dilution: 1.0 ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PANX1Sample Type: Hela whole cell lysatesAntibody Dilution: 1.0ug/mlPANX1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: PANX1Sample Type: Hela whole cell lysatesAntibody Dilution: 1.0ug/mlPANX1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: PANX1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PANX1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Mouse Retina and Knockout PANX-1 Mouse Tissue)

IHC (Immunohistochemistry) (Sample Type: Mouse Retina and Knockout PANX-1 Mouse Tissue)

IHC (Immunohistochemistry)

(Rabbit Anti-PANX1 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry) (Rabbit Anti-PANX1 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Intestine)

IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-PANX1 antibody
This is a rabbit polyclonal antibody against PANX1. It was validated on Western Blot and immunohistochemistry

Target Description: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.
Product Categories/Family for anti-PANX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
pannexin-1
NCBI Official Synonym Full Names
pannexin 1
NCBI Official Symbol
PANX1
NCBI Official Synonym Symbols
PX1; MRS1; UNQ2529
NCBI Protein Information
pannexin-1
UniProt Protein Name
Pannexin-1
UniProt Gene Name
PANX1
UniProt Synonym Gene Names
MRS1
UniProt Entry Name
PANX1_HUMAN

Similar Products

Product Notes

The PANX1 panx1 (Catalog #AAA23505) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PANX1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PANX1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PANX1 panx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGYYFSLSSL SDEFVCSIKS GILRNDSTVP DQFQCKLIAV GIFQLLSVIN. It is sometimes possible for the material contained within the vial of "PANX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.