Mouse anti-Human FOXA1 Monoclonal Antibody | anti-FOXA1 antibody

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (AP)

Cat. Num. AAA24215

• Gene Names: FOXA1; HNF3A; TCF3A
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FOXA1; Monoclonal Antibody; FOXA1 (Forkhead Box A1; Hepatocyte Nuclear Factor 3 alpha; HNF-3-alpha; HNF3A; HNF-3A; MGC33105; Transcription Factor 3A; TCF3A; TCF-3A) (AP); anti-FOXA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D7
• Specificity: Recognizes human FOXA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FOXA1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa367-472 from human FOXA1 (NP_004487) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged FOXA1 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody Lane 1: FOXA1 transfected lysate (49.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(FOXA1 monoclonal antibody Western Blot analysis of FOXA1 expression in HepG2)

WB (Western Blot)

(Western Blot detection against Immunogen (37.4kD).)

Product Categories/Family for anti-FOXA1 antibody

Antibodies; Transcription Factors

References

1. Association of GATA3, P53, Ki67 status and vascular peritumoral invasion are strongly prognostic in luminal breast cancer. Jacquemier J, Charafe-Jauffret E, Monville F, Esterni B, Extra JM, Houvenaeghel G, Xerri L, Bertucci F, Birnbaum D.Breast Cancer Res. 2009;11(2):R23. Epub 2009 Apr 30. 2. Estrogen induces repression of the breast cancer and salivary gland expression gene in an estrogen receptor alpha-dependent manner. Bretschneider N, Brand H, Miller N, Lowery AJ, Kerin MJ, Gannon F, Denger S.Cancer Res. 2008 Jan 1;68(1):106-14.

NCBI and Uniprot Product Information

• NCBI GI #: 24497501
• NCBI GeneID: 3169
• NCBI Accession #: NP_004487
• NCBI GenBank Nucleotide #: NM_004496
• UniProt Accession #: P55317; Q9H2A0; B2R9H6; B7ZAP5
• Molecular Weight: 52 kDa
• NCBI Official Full Name: hepatocyte nuclear factor 3-alpha
• NCBI Official Synonym Full Names: forkhead box A1
• NCBI Official Symbol: FOXA1
• NCBI Official Synonym Symbols: HNF3A; TCF3A
• NCBI Protein Information: hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
• UniProt Protein Name: Hepatocyte nuclear factor 3-alpha
• UniProt Gene Name: FOXA1
• UniProt Synonym Gene Names: HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
• UniProt Entry Name: FOXA1_HUMAN