Mouse FOXA1 Monoclonal Antibody | anti-FOXA1 antibody

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC)

Cat. Num. AAA26083

• Gene Names: FOXA1; HNF3A; TCF3A
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: FOXA1, Antibody; FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC); Forkhead Box A1; HNF3A; MGC33105; TCF3A; anti-FOXA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B1
• Specificity: Recognizes FOXA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-FOXA1 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FOXA1 (NP_004487, 367aa-472aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged FOXA1 is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(FOXA1 monoclonal antibody (M02), clone 1B1 Western Blot analysis of FOXA1 expression in HepG2.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA1 on HepG2 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA1 on HepG2 cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Related Product Information for anti-FOXA1 antibody

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq]

Product Categories/Family for anti-FOXA1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 24497501
• NCBI GeneID: 3169
• NCBI Accession #: NP_004487
• NCBI GenBank Nucleotide #: NM_004496.3
• UniProt Accession #: P55317; Q9H2A0; B2R9H6; B7ZAP5
• Molecular Weight: 52 kDa
• NCBI Official Full Name: hepatocyte nuclear factor 3-alpha
• NCBI Official Synonym Full Names: forkhead box A1
• NCBI Official Symbol: FOXA1
• NCBI Official Synonym Symbols: HNF3A; TCF3A
• NCBI Protein Information: hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
• UniProt Protein Name: Hepatocyte nuclear factor 3-alpha
• UniProt Gene Name: FOXA1
• UniProt Synonym Gene Names: HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
• UniProt Entry Name: FOXA1_HUMAN