Loading...

Skip to main content
WB (Western Blot) (Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human FOXA1 Monoclonal Antibody | anti-FOXA1 antibody

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (Biotin)

Gene Names
FOXA1; HNF3A; TCF3A
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXA1, Antibody; FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (Biotin); anti-FOXA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human FOXA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FOXA1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa367-472 from human FOXA1 (NP_004487) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged FOXA1 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged FOXA1 is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody Lane 1: FOXA1 transfected lysate (49.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody Lane 1: FOXA1 transfected lysate (49.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(FOXA1 monoclonal antibody Western Blot analysis of FOXA1 expression in HepG2)

WB (Western Blot) (FOXA1 monoclonal antibody Western Blot analysis of FOXA1 expression in HepG2)

WB (Western Blot)

(Western Blot detection against Immunogen (37.4kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.4kD).)
Product Categories/Family for anti-FOXA1 antibody
References
1. Association of GATA3, P53, Ki67 status and vascular peritumoral invasion are strongly prognostic in luminal breast cancer. Jacquemier J, Charafe-Jauffret E, Monville F, Esterni B, Extra JM, Houvenaeghel G, Xerri L, Bertucci F, Birnbaum D.Breast Cancer Res. 2009;11(2):R23. Epub 2009 Apr 30. 2. Estrogen induces repression of the breast cancer and salivary gland expression gene in an estrogen receptor alpha-dependent manner. Bretschneider N, Brand H, Miller N, Lowery AJ, Kerin MJ, Gannon F, Denger S.Cancer Res. 2008 Jan 1;68(1):106-14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
UniProt Protein Name
Hepatocyte nuclear factor 3-alpha
UniProt Gene Name
FOXA1
UniProt Synonym Gene Names
HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
UniProt Entry Name
FOXA1_HUMAN

Similar Products

Product Notes

The FOXA1 foxa1 (Catalog #AAA24806) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA1 foxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.