Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (SMAD1 monoclonal antibody Western Blot analysis of SMAD1 expression in A-549.)

Mouse anti-Human SMAD1 Monoclonal Antibody | anti-SMAD1 antibody

SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) APC

Gene Names
SMAD1; BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAD1; Monoclonal Antibody; SMAD1 (Mothers Against Decapentaplegic Homolog 1; Mothers Against DPP Homolog 1; MAD Homolog 1; MADH1; SMAD Family Member 1; SMAD 1; hSMAD1; BSP-1; BSP1; JV4-1; JV41; Mad-related Protein 1; MADR1; Transforming Growth Factor-beta-signaling Protein 1) APC; anti-SMAD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D3
Specificity
Recognizes human SMAD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SMAD1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human SMAD1 (NP_005891) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(SMAD1 monoclonal antibody Western Blot analysis of SMAD1 expression in A-549.)

WB (Western Blot) (SMAD1 monoclonal antibody Western Blot analysis of SMAD1 expression in A-549.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.84kD).)

Application Data

(Detection limit for recombinant GST tagged SMAD1 is ~3ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged SMAD1 is ~3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human salivary gland tissue. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human salivary gland tissue. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 monoclonal antibody. Lane 1: SMAD1 transfected lysate (52.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of SMAD1 expression in transfected 293T cell line by SMAD1 monoclonal antibody. Lane 1: SMAD1 transfected lysate (52.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SMAD1 monoclonal antibody. Western Blot analysis of SMAD1 expression in MES-SA/Dx5.)

WB (Western Blot) (SMAD1 monoclonal antibody. Western Blot analysis of SMAD1 expression in MES-SA/Dx5.)
Product Categories/Family for anti-SMAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
mothers against decapentaplegic homolog 1
NCBI Official Synonym Full Names
SMAD family member 1
NCBI Official Symbol
SMAD1
NCBI Official Synonym Symbols
BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
NCBI Protein Information
mothers against decapentaplegic homolog 1
UniProt Protein Name
Mothers against decapentaplegic homolog 1
UniProt Gene Name
SMAD1
UniProt Synonym Gene Names
BSP1; MADH1; MADR1; MAD homolog 1; Mothers against DPP homolog 1; SMAD 1; Smad1; hSMAD1; BSP-1
UniProt Entry Name
SMAD1_HUMAN

Similar Products

Product Notes

The SMAD1 smad1 (Catalog #AAA24657) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD1 smad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.