Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western Blot detection against Immunogen (60.94kD).)

Mouse anti-Human ANXA5 Monoclonal Antibody | anti-ANXA5 antibody

ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII,

Gene Names
ANXA5; PP4; ANX5; ENX2; RPRGL3; HEL-S-7
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANXA5; Monoclonal Antibody; ANXA5 (Annexin A5; Annexin-5; Annexin V; Lipocortin V; Endonexin II; Calphobindin I; CBP-I; Placental Anticoagulant Protein I; PAP-I; Placental Anticoagulant Protein 4; PP4; Thromboplastin Inhibitor; Vascular Anticoagulant-alpha; VAC-alpha; Anchorin CII; ; anti-ANXA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F4-1A5
Specificity
Recognizes human ANXA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ANXA5 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-320 from human ANXA5 (AAH01429) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (60.94kD).)

WB (Western Blot) (Western Blot detection against Immunogen (60.94kD).)

IP (Immunoprecipitation)

(Immunoprecipitation of ANXA5 transfected lysate using ANXA5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ANXA5 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of ANXA5 transfected lysate using ANXA5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ANXA5 rabbit polyclonal antibody.)

Application Data

(Detection limit for recombinant GST tagged ANXA5 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged ANXA5 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody. Lane 1: ANXA5 transfected lysate (35.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody. Lane 1: ANXA5 transfected lysate (35.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ANXA5 monoclonal antibody, Western Blot analysis of ANXA5 expression in Hela.)

WB (Western Blot) (ANXA5 monoclonal antibody, Western Blot analysis of ANXA5 expression in Hela.)
Product Categories/Family for anti-ANXA5 antibody
References
1. Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: A pilot Proteomics-based study. Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F.Biochem Biophys Res Commun. 2012 Apr 6;420(2):357-63. Epub 2012 Mar 8. 2. Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells. Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.J Proteomics. 2011 Nov 7. 3. The Differential Expression of Aqueous Soluble Proteins in Breast Normal and Cancerous Tissues in Relation to Stage and Grade of Patients. Liang S, Singh M, Gam LH.Journal of Biomedicine and Biotechnology doi:10.1155/ 2010/516469

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
308
Molecular Weight
35,937 Da
NCBI Official Full Name
Homo sapiens annexin A5, mRNA
NCBI Official Synonym Full Names
annexin A5
NCBI Official Symbol
ANXA5
NCBI Official Synonym Symbols
PP4; ANX5; ENX2; RPRGL3; HEL-S-7
NCBI Protein Information
annexin A5

Similar Products

Product Notes

The ANXA5 (Catalog #AAA24728) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANXA5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANXA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.