Mouse anti-Human, Rat TAB1 Monoclonal Antibody | anti-TAB1 antibody

TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (FITC)

Cat. Num. AAA25270

• Gene Names: TAB1; 3'-Tab1; MAP3K7IP1
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAB1; Monoclonal Antibody; TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1; Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1; TGF-beta-activated Kinase 1-binding Protein 1; TAK1-binding Protein 1; MAP3K7IP1) (FITC); anti-TAB1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A12
• Specificity: Recognizes human MAP3K7IP1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TAB1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_705717) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in PC-12.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with HSPA1L rabbit purified polyclonal 1:1200 and MAP3K7IP1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged MAP3K7IP1 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.89kD).)

Product Categories/Family for anti-TAB1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 41281798
• NCBI GeneID: 10454
• NCBI Accession #: NP_705717
• NCBI GenBank Nucleotide #: NM_153497
• UniProt Accession #: Q8IZW2; Q15750
• Molecular Weight: 50kDa
• NCBI Official Full Name: TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform beta
• NCBI Official Synonym Full Names: TGF-beta activated kinase 1 (MAP3K7) binding protein 1
• NCBI Official Symbol: TAB1
• NCBI Official Synonym Symbols: 3'-Tab1; MAP3K7IP1
• NCBI Protein Information: TGF-beta-activated kinase 1 and MAP3K7-binding protein 1