Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse TTF2 Monoclonal Antibody | anti-TTF2 antibody

TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (AP)

Gene Names
TTF2; HuF2; ZGRF6
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TTF2; Monoclonal Antibody; TTF2 (Transcription Termination Factor; RNA Polymerase II; HuF2) (AP); Transcription Termination Factor; HuF2; anti-TTF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
100000000
Specificity
Recognizes TTF2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TTF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TTF2 (NP_003585, 2aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in PC-12.)

WB (Western Blot) (TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in PC-12.)

WB (Western Blot)

(TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Hela S3 NE.)

WB (Western Blot) (TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Hela S3 NE.)

WB (Western Blot)

(TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Y-79.)

WB (Western Blot) (TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Y-79.)

WB (Western Blot)

(TTF2 monoclonal antibody (M06), clone 1E8 Western Blot analysis of TTF2 expression in NIH/3T3.)

WB (Western Blot) (TTF2 monoclonal antibody (M06), clone 1E8 Western Blot analysis of TTF2 expression in NIH/3T3.)

WB (Western Blot)

(TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in human placenta.)

WB (Western Blot) (TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in human placenta.)
Related Product Information for anti-TTF2 antibody
This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing. [provided by RefSeq]
Product Categories/Family for anti-TTF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,128 Da
NCBI Official Full Name
transcription termination factor 2
NCBI Official Synonym Full Names
transcription termination factor, RNA polymerase II
NCBI Official Symbol
TTF2
NCBI Official Synonym Symbols
HuF2; ZGRF6
NCBI Protein Information
transcription termination factor 2; F2; RNA polymerase II termination factor; human factor 2; lodestar homolog; lodestar protein; transcription release factor 2; zinc finger, GRF-type containing 6
UniProt Protein Name
Transcription termination factor 2
UniProt Gene Name
TTF2
UniProt Synonym Gene Names
F2; HuF2
UniProt Entry Name
TTF2_HUMAN

Similar Products

Product Notes

The TTF2 ttf2 (Catalog #AAA25937) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TTF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TTF2 ttf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TTF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.